Sequences
EST Library Info
plac3Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000169490 (click for geneview)
Transcript ID ENST00000316221(link to ensembl)
Symbol NP_510882.1
Localtion Chromosome:8:38967481:38973193:-1 band: 8p11.23
Description BBP-like protein 1 isoform a
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--V--L--G--G--C--P--V--S--Y--L--L--L--C--G--Q--A--A--L--L--L--G--N--L--L--L--L--H--C--V--S--R--S--
ATGGTGCTAGGTGGTTGCCCGGTTAGTTACTTACTTCTGTGCGGCCAGGCGGCTTTGCTGCTGGGGAATTTACTTCTGCTGCATTGTGTGTCTCGGAGCC
::::: ::::::::::::::::: :::::::::::.::::::::::::::::: :::::::::::::::.:.::::::::::::::::: ::::::::::
ATGGTTCTAGGTGGTTGCCCGGTGAGTTACTTACTCCTGTGCGGCCAGGCGGCATTGCTGCTGGGGAATCTGCTTCTGCTGCATTGTGTCTCTCGGAGCC
-M--V--L--G--G--C--P--V--S--Y--L--L--L--C--G--Q--A--A--L--L--L--G--N--L--L--L--L--H--C--V--S--R--S--

----------------------------------------------------------------------------------------------------
H--S--Q--N--A--T--A--E--P--E--L--T--S--A--G--A--A--Q--P--E--G--P--G--G--A--A--S--W--E--Y--G--D--P--H
ACTCGCAAAATGCGACCGCTGAGCCTGAGCTCACATCCGCTGGCGCCGCCCAGCCGGAGGGCCCCGGGGGTGCTGCGAGCTGGGAATATGGCGACCCCCA
::::::: ::..: :: :: :::::.:::.::::: : :: :::::::::::::.:::::::.::.  ::.::. .::::::::::::::::::::::::
ACTCGCACAACACCACGGCGGAGCCCGAGTTCACAACGGCAGGCGCCGCCCAGCTGGAGGGCTCCACCGGCGCCTTGAGCTGGGAATATGGCGACCCCCA
H--S--H--N--T--T--A--E--P--E--F--T--T--A--G--A--A--Q--L--E--G--S--T--G--A--L--S--W--E--Y--G--D--P--Q

--------------------------><------------------------------------------------------------------------
--S--P--V--I--L--C--S--Y--L--P--D--E--F--I--E--C--E--D--P--V--D--H--V--G--N--A--T--A--S--Q--E--L--G-
CTCTCCGGTCATCCTCTGCTCTTACCTACCTGATGAATTTATAGAATGTGAAGACCCAGTGGATCATGTTGGAAATGCAACTGCATCCCAGGAACTTGGT
 :::::.::::::::.:::::::::   ::.:::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::
ATCTCCAGTCATCCTTTGCTCTTAC---CCCGATGAATTTATAGAATGTGAAGACCCAGTGGATCATGTTGGAAATGCAACAGCATCCCAGGAACTTGGT
--S--P--V--I--L--C--S--Y-----P--D--E--F--I--E--C--E--D--P--V--D--H--V--G--N--A--T--A--S--Q--E--L--G-

--------------><------------------------------------------------------------------------------------
-Y--G--C--L--K--F--G--G--Q--A--Y--S--D--V--E--H--T--S--V--Q--C--H--A--L--D--G--I--E--C--A--S--P--R--
TATGGTTGTCTCAAGTTCGGCGGTCAGGCCTACAGCGACGTGGAACACACTTCAGTCCAGTGCCATGCCTTAGATGGAATTGAGTGTGCCAGTCCTAGGA
::::::::::::::::::::.::.:::::::::::.::.:::::.:::::::: ::.:::::::. :::.: ::.:::::.:::::.:::::::::::::
TATGGTTGTCTCAAGTTCGGTGGCCAGGCCTACAGTGATGTGGAGCACACTTCCGTTCAGTGCCGGGCCCTCGACGGAATCGAGTGCGCCAGTCCTAGGA
-Y--G--C--L--K--F--G--G--Q--A--Y--S--D--V--E--H--T--S--V--Q--C--R--A--L--D--G--I--E--C--A--S--P--R--

------------------------------><--------------------------------------------------------------------
T--F--L--R--E--N--K--P--C--I--K--Y--T--G--H--Y--F--I--T--T--L--L--Y--S--F--F--L--G--C--F--G--V--D--R
CCTTTCTACGAGAAAATAAACCTTGTATAAAGTATACCGGACACTACTTCATAACCACTTTACTCTACTCCTTCTTCCTGGGATGTTTTGGTGTGGATCG
::::.::::::::.::.::.:::::::::   :::::::::::::::::::::::::::::.::::::::.:::::: ::::::::::::: ::.:::::
CCTTCCTACGAGAGAACAAGCCTTGTATA---TATACCGGACACTACTTCATAACCACTTTGCTCTACTCTTTCTTCATGGGATGTTTTGGAGTAGATCG
T--F--L--R--E--N--K--P--C--I-----Y--T--G--H--Y--F--I--T--T--L--L--Y--S--F--F--M--G--C--F--G--V--D--R

----------------------------------------------------------------------------------------------------
--F--C--L--G--H--T--G--T--A--V--G--K--L--L--T--L--G--G--L--G--I--W--W--F--V--D--L--I--L--L--I--T--G-
ATTCTGTTTGGGACACACTGGCACTGCAGTAGGGAAGCTGTTGACGCTTGGAGGACTTGGGATTTGGTGGTTTGTTGACCTTATTTTGCTAATTACTGGA
 :::::. :::::::::::::::: :::::.:::::::: ::::: ::::::::::::::::::::::::::::::::::::::::::::.::.::::::
TTTCTGCATGGGACACACTGGCACAGCAGTGGGGAAGCTCTTGACTCTTGGAGGACTTGGGATTTGGTGGTTTGTTGACCTTATTTTGCTGATCACTGGA
--F--C--M--G--H--T--G--T--A--V--G--K--L--L--T--L--G--G--L--G--I--W--W--F--V--D--L--I--L--L--I--T--G-

-------------------------------------------->
-G--L--M--P--S--D--G--S--N--W--C--T--V--Y--*-
GGGCTGATGCCAAGTGATGGCAGCAACTGGTGCACTGTTTACTAA
::.:::::::: :::::.::::::::.::::::::..::::::::
GGACTGATGCCCAGTGACGGCAGCAATTGGTGCACCATTTACTAA
-G--L--M--P--S--D--G--S--N--W--C--T--I--Y--*-

Pig Consensus Sequence

>BGISUST0000887135
ATGGTTCTAGGTGGTTGCCCGGTGAGTTACTTACTCCTGTGCGGCCAGGCGGCATTGCTGCTGGGGAATCTGCTTCTGCTGCATTGTGTCTCTCGGAGCC
ACTCGCACAACACCACGGCGGAGCCCGAGTTCACAACGGCAGGCGCCGCCCAGCTGGAGGGCTCCACCGGCGCCTTGAGCTGGGAATATGGCGACCCCCA
ATCTCCAGTCATCCTTTGCTCTTAC---CCCGATGAATTTATAGAATGTGAAGACCCAGTGGATCATGTTGGAAATGCAACAGCATCCCAGGAACTTGGT
TATGGTTGTCTCAAGTTCGGTGGCCAGGCCTACAGTGATGTGGAGCACACTTCCGTTCAGTGCCGGGCCCTCGACGGAATCGAGTGCGCCAGTCCTAGGA
CCTTCCTACGAGAGAACAAGCCTTGTATA---TATACCGGACACTACTTCATAACCACTTTGCTCTACTCTTTCTTCATGGGATGTTTTGGAGTAGATCG
TTTCTGCATGGGACACACTGGCACAGCAGTGGGGAAGCTCTTGACTCTTGGAGGACTTGGGATTTGGTGGTTTGTTGACCTTATTTTGCTGATCACTGGA
GGACTGATGCCCAGTGACGGCAGCAATTGGTGCACCATTTACTAA


>BGISUSP0000887135
MVLGGCPVSYLLLCGQAALLLGNLLLLHCVSRSHSHNTTAEPEFTTAGAAQLEGSTGALSWEYGDPQSPVILCSY-PDEFIECEDPVDHVGNATASQELG
YGCLKFGGQAYSDVEHTSVQCRALDGIECASPRTFLRENKPCI-YTGHYFITTLLYSFFMGCFGVDRFCMGHTGTAVGKLLTLGGLGIWWFVDLILLITG
GLMPSDGSNWCTIY*