Sequences
EST Library Info
aor2Aorta
cut2Uterus - RNA from China
dbla2Unavailable
ebs4Foetus 50 days, brain stem
gul4Gullet
lin2Large intestine
lyg3Lymphatic gland
mgp2Mammary gland - 7 days pre birth
ova4Ovary
pan2Pancreas
pfco3Unavailable
pgl2Pituitary gland
pigcb1Unavailable
pliv7Unavailable
ret1Retina
sag1Salivary gland
spl10Spleen
tes4Testes
thg8Thyroid gland
tra2Trachea
uio4Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000113240 (click for geneview)
Transcript ID ENST00000316308(link to ensembl)
Symbol CLK4
Localtion Chromosome:5:177962272:177986660:-1 band: 5q35.3
Description Dual specificity protein kinase CLK4 (EC 2.7.1.37) (EC 2.7.1.112) (CDC-like kinase 4). [Source:Uniprot/SWISSPROT;Acc:Q9HAZ1]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--R--H--S--K--R--T--H--C--P--D--W--D--S--R--E--S--W--G--H--E--S--Y--R--G--S--H--K--R--K--R--R--S--
ATGCGGCATTCCAAAAGAACTCACTGTCCTGATTGGGATAGCAGAGAAAGCTGGGGACATGAAAGCTATCGTGGAAGTCACAAGCGGAAGAGGAGATCTC
::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::. :::::::::::::.::::::::::::::.:
ATGCGGCATTCCAAAAGAACTCACTGCCCTGATTGGGATAGCAGAGAAAGCTGGGGACATGAAAGCTACAGTGGAAGTCACAAACGGAAGAGGAGATCCC
-M--R--H--S--K--R--T--H--C--P--D--W--D--S--R--E--S--W--G--H--E--S--Y--S--G--S--H--K--R--K--R--R--S--

------------------------------------------------------------><--------------------------------------
H--S--S--T--Q--E--N--R--H--C--K--P--H--H--Q--F--K--E--S--D--C--H--Y--L--E--A--R--S--L--N--E--R--D--Y
ATAGTAGCACACAAGAGAACAGGCATTGTAAACCACATCACCAGTTTAAAGAATCTGATTGTCATTATTTAGAAGCAAGGTCCTTGAATGAGCGAGATTA
:.:::::.::::::::::::::.::::::::::::::::::::::::::::::::::::   :::::::::::::::::::::::::::::: :::::::
ACAGTAGTACACAAGAGAACAGACATTGTAAACCACATCACCAGTTTAAAGAATCTGAT---CATTATTTAGAAGCAAGGTCCTTGAATGAGAGAGATTA
H--S--S--T--Q--E--N--R--H--C--K--P--H--H--Q--F--K--E--S--D-----H--Y--L--E--A--R--S--L--N--E--R--D--Y

----------------------------------------------------------------------------------------------------
--R--D--R--R--Y--V--D--E--Y--R--N--D--Y--C--E--G--Y--V--P--R--H--Y--H--R--D--I--E--S--G--Y--R--I--H-
TCGGGACCGGAGATACGTTGACGAATACAGGAATGACTACTGTGAAGGATATGTTCCTAGACATTATCACAGAGACATTGAAAGCGGGTATCGAATCCAC
::::::::::::::::.::::.::::::::.:::::::::::.:::.::::::::::::::::::::::::::::::::::::::.: :::::::::::.
TCGGGACCGGAGATACATTGATGAATACAGAAATGACTACTGCGAAAGATATGTTCCTAGACATTATCACAGAGACATTGAAAGCAGTTATCGAATCCAT
--R--D--R--R--Y--I--D--E--Y--R--N--D--Y--C--E--R--Y--V--P--R--H--Y--H--R--D--I--E--S--S--Y--R--I--H-

-----------------------------------------------------------------------------------><---------------
-C--S--K--S--S--V--R--S--R--R--S--S--P--K--R--K--R--N--R--H--C--S--S--H--Q--S--R--S--K--S--H--R--R--
TGCAGTAAATCTTCAGTCCGCAGCAGGAGAAGCAGTCCTAAAAGGAAGCGCAATAGACACTGTTCAAGTCATCAGTCACGTTCGAAGAGCCACCGAAGGA
:::::::::::::::::::: ::::::::::::::::.:::::::::.::.:::::::::::::::::::::::::::::::::::::::::::::::::
TGCAGTAAATCTTCAGTCCGAAGCAGGAGAAGCAGTCTTAAAAGGAAACGTAATAGACACTGTTCAAGTCATCAGTCACGTTCGAAGAGCCACCGAAGGA
-C--S--K--S--S--V--R--S--R--R--S--S--L--K--R--K--R--N--R--H--C--S--S--H--Q--S--R--S--K--S--H--R--R--

-----------------------------------------------------------------------------><---------------------
K--R--S--R--S--I--E--D--D--E--E--G--H--L--I--C--Q-----S--G--D--V--L--R--A--R--Y--E--I--V--D--T--L--G
AAAGATCCAGGAGTATAGAGGATGATGAGGAGGGTCACCTGATCTGTCAA---AGTGGAGACGTTCTAAGAGCAAGATATGAAATCGTGGACACTTTGGG
::::::::::::::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::   ::::::::::::::::::::
AAAGATCCAGGAGTATAGAGGATGATGAGGAGGGTCACCTGATCTGTCAAG--AGTGGAGACGTTCTAAGAGCAAGA---GAAATCGTGGACACTTTGGG
K--R--S--R--S--I--E--D--D--E--E--G--H--L--I--C--Q--\--S--G--D--V--L--R--A--R-----E--I--V--D--T--L--G

--------------------------------------------><------------------------------------------------------
--E--G--A--F--G--K--V--V--E--C--I--D--H--G--M--D--G--M--H--V--A--V--K--I--V--K--N--V--G--R--Y--R--E-
TGAAGGAGCCTTTGGCAAAGTTGTAGAGTGCATTGATCATGGCATGGATGGCATGCATGTAGCAGTGAAAATCGTAAAAAATGTAGGCCGTTACCGTGAA
::::::.::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::.:::::::::::.::.:: ::.::::::
TGAAGGGGCCTTTGGCAAAGTTGTAGAGTGCATTGATCATGGC---GATGGCATGCATGTAGCAGTGAAAATTGTAAAAAATGTGGGTCGATATCGTGAA
--E--G--A--F--G--K--V--V--E--C--I--D--H--G-----D--G--M--H--V--A--V--K--I--V--K--N--V--G--R--Y--R--E-

-------------------------------------------------------------><-------------------------------------
-A--A--R--S--E--I--Q--V--L--E--H--L--N--S--T--D--P--N--S--V--F--R--C--V--Q--M--L--E--W--F--D--H--H--
GCAGCTCGTTCAGAAATCCAAGTATTAGAGCACTTAAATAGTACTGATCCCAATAGTGTCTTCCGATGTGTCCAGATGCTAGAATGGTTTGATCATCATG
::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::
GCAGCTCGTTCAGAAATCCAAGTATTGGAGCATTTAAATAGTACTGATCCCAATAGTGTC---CGATGTGTCCAGATGCTAGAATGGTTTGATCATCATG
-A--A--R--S--E--I--Q--V--L--E--H--L--N--S--T--D--P--N--S--V-----R--C--V--Q--M--L--E--W--F--D--H--H--

----------------------------------------------------------------------------------------------------
G--H--V--C--I--V--F--E--L--L--G--L--S--T--Y--D--F--I--K--E--N--S--F--L--P--F--Q--I--D--H--I--R--Q--M
GTCATGTTTGTATTGTGTTTGAACTACTGGGACTTAGTACTTACGATTTCATTAAAGAAAACAGCTTTCTGCCATTTCAAATTGACCACATCAGGCAGAT
::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::.:::::::::::::::::::::::::::::::::::.::
GTCATGTTTGTATTGTGTTTGAACTACTGGGACTTAGTACCTATGATTTCATTAAAGAAAATAGCTTTCTGCCATTTCAAATTGACCACATCAGGCAAAT
G--H--V--C--I--V--F--E--L--L--G--L--S--T--Y--D--F--I--K--E--N--S--F--L--P--F--Q--I--D--H--I--R--Q--M

----------------------------><----------------------------------------------------------------------
--A--Y--Q--I--C--Q--S--I--N--F--L--H--H--N--K--L--T--H--T--D--L--K--P--E--N--I--L--F--V--K--S--D--Y-
GGCGTATCAGATCTGCCAGTCAATAAATTTTTTACATCATAATAAATTAACCCATACAGATCTGAAGCCTGAAAATATTTTGTTTGTGAAGTCTGACTAT
:::.:::::::::::.::::::::::::   .:.:::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::
GGCATATCAGATCTGTCAGTCAATAAAT---CTGCATCATAATAAATTAACCCATACAGATCTGAAGCCTGAAAATATTTTATTTGTGAAGTCTGACTAT
--A--Y--Q--I--C--Q--S--I--N-----L--H--H--N--K--L--T--H--T--D--L--K--P--E--N--I--L--F--V--K--S--D--Y-

-----------------------><---------------------------------------------------------------------------
-V--V--K--Y--N--S--K--M--K--R--D--E--R--T--L--K--N--T--D--I--K--V--V--D--F--G--S--A--T--Y--D--D--E--
GTAGTCAAATATAATTCTAAAATGAAACGTGATGAACGCACACTGAAAAACACAGATATCAAAGTTGTTGACTTTGGAAGTGCAACGTATGATGATGAAC
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::.::.::::::::::
GTAGTCAAATATAATTCTAAAATGAAACGTGATGAACGCACACTGAAAAACACAGATATCAAAGTTGTTGATTTTGGAAGTGCAACATACGATGATGAAC
-V--V--K--Y--N--S--K--M--K--R--D--E--R--T--L--K--N--T--D--I--K--V--V--D--F--G--S--A--T--Y--D--D--E--

-----------------------------------------------------><---------------------------------------------
H--H--S--T--L--V--S--T--R--H--Y--R--A--P--E--V--I--L--A--L--G--W--S--Q--P--C--D--V--W--S--I--G--C--I
ATCACAGTACTTTGGTGTCTACCCGGCACTACAGAGCTCCCGAGGTCATTTTGGCTTTAGGTTGGTCTCAGCCTTGTGATGTTTGGAGCATAGGTTGCAT
::::.:::::::::::.::::: :::::.::::::::.:: :::::::::            ::::::::::::::::::::::::::::::::::::::
ATCATAGTACTTTGGTATCTACACGGCATTACAGAGCCCCAGAGGTCATT------------TGGTCTCAGCCTTGTGATGTTTGGAGCATAGGTTGCAT
H--H--S--T--L--V--S--T--R--H--Y--R--A--P--E--V--I--------------W--S--Q--P--C--D--V--W--S--I--G--C--I

------------------------------------><--------------------------------------------------------------
--L--I--E--Y--Y--L--G--F--T--V--F--Q--T--H--D--S--K--E--H--L--A--M--M--E--R--I--L--G--P--I--P--Q--H-
TCTTATTGAATATTACCTTGGTTTCACAGTCTTTCAGACTCATGATAGTAAAGAGCACCTGGCAATGATGGAACGAATATTAGGACCCATACCACAACAC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::  ::::
TCTTATTGAATATTACCTTGGTTTCACAGTCTTTCAGACTCATGATAGTAAAGAGCACCTGGCAATGATGGAACGAATATTAGGACCCATACCAACACAC
--L--I--E--Y--Y--L--G--F--T--V--F--Q--T--H--D--S--K--E--H--L--A--M--M--E--R--I--L--G--P--I--P--T--H-

----------------><----------------------------------------------------------------------------------
-M--I--Q--K--T--R--K--R--K--Y--F--H--H--N--Q--L--D--W--D--E--H--S--S--A--G--R--Y--V--R--R--R--C--K--
ATGATTCAGAAAACAAGAAAACGCAAGTATTTTCACCATAACCAGCTAGATTGGGATGAACACAGTTCTGCTGGTAGATATGTTAGGAGACGCTGCAAAC
:::::::::::::::   :::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::
ATGATTCAGAAAACA---AAACGCAAGTATTTTCATCATAACCAGCTAGATTGGGATGAACATAGTTCTGCTGGTAGATATGTTAGGAGACGCTGCAAAC
-M--I--Q--K--T-----K--R--K--Y--F--H--H--N--Q--L--D--W--D--E--H--S--S--A--G--R--Y--V--R--R--R--C--K--

-------><-------------------------------------------------------------------------------------------
P--L--K--E--F--M--L--C--H--D--E--E--H--E--K--L--F--D--L--V--R--R--M--L--E--Y--D--P--T--Q--R--I--T--L
CGTTGAAGGAATTTATGCTTTGTCATGATGAAGAACATGAGAAACTGTTTGACCTGGTTCGAAGAATGTTAGAATATGATCCAACTCAAAGAATTACCTT
:.::.:::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ..  :::::::::::::
CATTAAAGGAGTTTATGCTTTGTCATGATGAAGAACATGAGAAACTGTTTGACCTGGTTCGAAGAATGTTAGAATATGATCCTGTGAAAAGAATTACCTT
P--L--K--E--F--M--L--C--H--D--E--E--H--E--K--L--F--D--L--V--R--R--M--L--E--Y--D--P--V--K--R--I--T--L

------------------------------------------------>
--D--E--A--L--Q--H--P--F--F--D--L--L--K--K--K--*-
GGATGAAGCATTGCAGCATCCTTTCTTTGACTTATTAAAAAAGAAATGA
:::::::::::::::::::::::::::::::::::::::::::::::::
GGATGAAGCATTGCAGCATCCTTTCTTTGACTTATTAAAAAAGAAATGA
--D--E--A--L--Q--H--P--F--F--D--L--L--K--K--K--*-

Pig Consensus Sequence

>BGISUST0000897960
ATGCGGCATTCCAAAAGAACTCACTGCCCTGATTGGGATAGCAGAGAAAGCTGGGGACATGAAAGCTACAGTGGAAGTCACAAACGGAAGAGGAGATCCC
ACAGTAGTACACAAGAGAACAGACATTGTAAACCACATCACCAGTTTAAAGAATCTGAT---CATTATTTAGAAGCAAGGTCCTTGAATGAGAGAGATTA
TCGGGACCGGAGATACATTGATGAATACAGAAATGACTACTGCGAAAGATATGTTCCTAGACATTATCACAGAGACATTGAAAGCAGTTATCGAATCCAT
TGCAGTAAATCTTCAGTCCGAAGCAGGAGAAGCAGTCTTAAAAGGAAACGTAATAGACACTGTTCAAGTCATCAGTCACGTTCGAAGAGCCACCGAAGGA
AAAGATCCAGGAGTATAGAGGATGATGAGGAGGGTCACCTGATCTGTCAaaGTGGAGACGTTCTAAGAGCAAGA---GAAATCGTGGACACTTTGGGTGA
AGGGGCCTTTGGCAAAGTTGTAGAGTGCATTGATCATGGC---GATGGCATGCATGTAGCAGTGAAAATTGTAAAAAATGTGGGTCGATATCGTGAAGCA
GCTCGTTCAGAAATCCAAGTATTGGAGCATTTAAATAGTACTGATCCCAATAGTGTC---CGATGTGTCCAGATGCTAGAATGGTTTGATCATCATGGTC
ATGTTTGTATTGTGTTTGAACTACTGGGACTTAGTACCTATGATTTCATTAAAGAAAATAGCTTTCTGCCATTTCAAATTGACCACATCAGGCAAATGGC
ATATCAGATCTGTCAGTCAATAAAT---CTGCATCATAATAAATTAACCCATACAGATCTGAAGCCTGAAAATATTTTATTTGTGAAGTCTGACTATGTA
GTCAAATATAATTCTAAAATGAAACGTGATGAACGCACACTGAAAAACACAGATATCAAAGTTGTTGATTTTGGAAGTGCAACATACGATGATGAACATC
ATAGTACTTTGGTATCTACACGGCATTACAGAGCCCCAGAGGTCATT------------TGGTCTCAGCCTTGTGATGTTTGGAGCATAGGTTGCATTCT
TATTGAATATTACCTTGGTTTCACAGTCTTTCAGACTCATGATAGTAAAGAGCACCTGGCAATGATGGAACGAATATTAGGACCCATACCAACACACATG
ATTCAGAAAACA---AAACGCAAGTATTTTCATCATAACCAGCTAGATTGGGATGAACATAGTTCTGCTGGTAGATATGTTAGGAGACGCTGCAAACCAT
TAAAGGAGTTTATGCTTTGTCATGATGAAGAACATGAGAAACTGTTTGACCTGGTTCGAAGAATGTTAGAATATGATCCTGTGAAAAGAATTACCTTGGA
TGAAGCATTGCAGCATCCTTTCTTTGACTTATTAAAAAAGAAATGA


>BGISUSP0000897960
MRHSKRTHCPDWDSRESWGHESYSGSHKRKRRSHSSTQENRHCKPHHQFKESD-HYLEARSLNERDYRDRRYIDEYRNDYCERYVPRHYHRDIESSYRIH
CSKSSVRSRRSSLKRKRNRHCSSHQSRSKSHRRKRSRSIEDDEEGHLICQSGDVLRAR-EIVDTLGEGAFGKVVECIDHG-DGMHVAVKIVKNVGRYREA
ARSEIQVLEHLNSTDPNSV-RCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSIN-LHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVI----WSQPCDVWSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPTHM
IQKT-KRKYFHHNQLDWDEHSSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPVKRITLDEALQHPFFDLLKKK*