Sequences
CB287820est
rhyp10c_e20.y1est
rhyp01c_m13.y1est
rlnt09c_n1.y1est
CV877337est
rjca09c_g17.y1est
rmed31c_p17.y1est
rfbs3923b_d8.y1est
rfhi4033b_i15.y1est
rpgl13_o14.y1est
BI185488est
rhyp10c_i13.y1est
CV877458est
rhyp16c_i6.y1est
rcsp12b_m17.y1est
rfcc16b_d4.y1est
rjca12c_g23.y1est
rhyp14c_p8.y1est
rnje26c_e5.y1est
rjca20c_c7.y1est
rfcc04b_g18.y1est
X93256est
CV877832est
rjca22c_d13.y1est
CV867355est
rcov24b_e5.y1est
rfbs3932b_n24.y1est
rcga28b_h5.y1est
CX057872est
rcli32b_c12.y1est
rcli36b_l4.y1est
AJ685407est
rcov29b_a2.y1est
rcly28b_m6.y1est
rute2113b_i11.y1est
rcli36b_p12.y1est
CB287821est
rpgl18_f17.y1est
rjca18c_m22.y1est
rhlv13b_k24.y1est
rhyp30c_g24.y1est
rjca05c_d24.y1est
rnca07b_h6.y1est
CV868414est
rpgl13_b12.y1est
CX057356est
rcly36b_j19.y1est
CV864452est
rfce19c_p10.y1est
rnmm27c_g19.y1est
rfcc31b_a22.y1est
CX057966est
rmed33c_j20.y1est
CV870914est
rfcc25b_g1.y1est
rcov25b_l15.y1est
rute2115b_d22.y1est
rfcc04b_p17.y1est
rfhi4027b_g20.y1est
rcov17b_i21.y1est
rcsp11b_l14.y1est
rcly29b_f23.y1est
rhyp20c_o20.y1est
rcov16b_o8.y1est
rpigcb_4192.y1est
rhyp08c_f14.y1est
CB285454est
rmcp20c_h3.y1est
BI182360est
CB285444est
rcli20b_d6.y1est
CV873807est
rlnt04c_l12.y1est
CX057999est
rcly31b_e18.y1est
DN133782est
rlnt05c_e17.y1est
recc2808c_p21.y1est
rjca09c_b3.y1est
CX059133est
rcsp07b_j15.y1est
rece03_a14r1.y1est
CX062736est
rhyp05c_p14.y1est
rmcp34c_e9.y1est
rjca01c_d12.y1est
rpigcb_1060.y1est
CX057256est
rcli10b_a14.y1est
rlnt12c_c11.y1est
rhyp31c_a18.y1est
rjca18c_k9.y1est
CX063828est
BP152563est
rhyp04c_c11.y1est
rnmm14c_g3.y1est
rjca11c_n24.y1est
rebs18c_a22.y1est
BI337269est
CN166766est
rjca22c_p19.y1est
EST Library Info
cga1Galactophore - RNA from China
cli4Liver - RNA from China
cly4Lymph - RNA from China
cov8Ovary - RNA from China
csp2Spleen - RNA from China
ebs1Foetus 50 days, brain stem
ecc1Foetus 50 days, cortex cerebri
ece2Foetus 50 days, cerebellum
fbs2Unavailable
fcc5Unavailable
fce1Foetus 100 days, cerebellum
fhi2Unavailable
hlv1Heart, left ventricle
hyp14Hypothalamus
jca16Joint capsule
lnt4Lymphatic nodule tracheobroncalis
mcp2Mammae, collostrum producing
med3Mediastinum
nca1Newborn 115 days, cartillage
nje1Newborn 115 days, jejunum
nmm2Newborn 115 days, mucosal membranes
pgl3Pituitary gland
pigcb2Unavailable
ute3Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000120885 (click for geneview)
Transcript ID ENST00000316403(link to ensembl)
Symbol CLU
Localtion Chromosome:8:27510369:27528244:-1 band: 8p21.1
Description Clusterin precursor (Complement-associated protein SP-40,40) (Complement cytolysis inhibitor) (CLI) (NA1/NA2) (Apolipoprotein J) (Apo-J) (Testosterone-repressed prostate message 2) (TRPM-2) [Contains: Clusterin beta chain (ApoJalpha) (Complement cytolysis [Source:Uniprot/SWISSPROT;Acc:P10909]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--Q--V--C--S--Q--P--Q--R--G--C--V--R--E--Q--S--A--I--N--T--A--P--P--S--A--H--N--A--A--S--P--G--G--
ATGCAGGTTTGCAGCCAGCCCCAAAGGGGGTGTGTGCGCGAGCAGAGCGCTATAAATACGGCGCCTCCCAGTGCCCACAACGCGGCGTCGCCAGGAGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------><------------------------------------------------------------------------
A--R--G--H--R--V--P--L--T--E--A--C--K--D--S--R--I--G--G--M--M--K--T--L--L--L--F--V--G--L--L--L--T--W
CGCGCGGGCACAGGGTGCCGCTGACCGAGGCGTGCAAAGACTCCAGAATTGGAGGCATGATGAAGACTCTGCTGCTGTTTGTGGGGCTGCTGCTGACCTG
                                                     :::. :::::::::::::::::: :: ::::::::::::::::::::
-----------------------------------------------------GGCGAGATGAAGACTCTGCTGCTCTTGGTGGGGCTGCTGCTGACCTG
------------------------------------------------------G--E--M--K--T--L--L--L--L--V--G--L--L--L--T--W

-------------------------------------------------------><-------------------------------------------
--E--S--G--Q-----V--L--G--D--Q--T--V--S--D--N--E--L--Q--E--M--S--N--Q--G--S--K--Y--V--N--K--E--I--Q-
GGAGAGTGGGCAG---GTCCTGGGGGACCAGACGGTCTCAGACAATGAGCTCCAGGAAATGTCCAATCAGGGAAGTAAGTACGTCAATAAGGAAATTCAA
:::::.::: :     :: ::::::::: ::.: .::::.::::: :::::::::   ::::::: . ::::.:::::::::::.:::::.:::::: ::
GGAGAATGGCCCCTGGGTGCTGGGGGACAAGGCCATCTCGGACAAAGAGCTCCAG---ATGTCCACCGAGGGGAGTAAGTACGTTAATAAAGAAATTAAA
--E--N--G--P--W--V--L--G--D--K--A--I--S--D--K--E--L--Q-----M--S--T--E--G--S--K--Y--V--N--K--E--I--K-

----------------------------------------------------------------------------------------------------
-N--A--V--N--G--V--K--Q--I--K--T--L--I--E--K--T--N--E--E--R--K--T--L--L--S--N--L--E--E--A--K--K--K--
AATGCTGTCAACGGGGTGAAACAGATAAAGACTCTCATAGAAAAAACAAACGAAGAGCGCAAGACACTGCTCAGCAACCTAGAAGAAGCCAAGAAGAAGA
:::::. :::: :.::::::::::::::::::.:: :::::: :: ::::.:::::::::::. :::::::::::  :::.::.::::::::::::::::
AATGCCCTCAAGGAGGTGAAACAGATAAAGACCCTAATAGAACAATCAAATGAAGAGCGCAAATCACTGCTCAGCTCCCTGGAGGAAGCCAAGAAGAAGA
-N--A--L--K--E--V--K--Q--I--K--T--L--I--E--Q--S--N--E--E--R--K--S--L--L--S--S--L--E--E--A--K--K--K--

----><----------------------------------------------------------------------------------------------
K--E--D--A--L--N--E--T--R--E--S--E--T--K--L--K--E--L--P--G--V--C--N--E--T--M--M--A--L--W--E--E--C--K
AAGAGGATGCCCTAAATGAGACCAGGGAATCAGAGACAAAGCTGAAGGAGCTCCCAGGAGTGTGCAATGAGACCATGATGGCCCTCTGGGAAGAGTGTAA
:::::::::::::.::.:: ::::::::  : ::::::::::::::::....:: .::  ::::::::::::: ::::::::::: :::::::::::.::
AAGAGGATGCCCTGAACGATACCAGGGATACTGAGACAAAGCTGAAGGGATCCCAGGGCTTGTGCAATGAGACGATGATGGCCCTGTGGGAAGAGTGCAA
K--E--D--A--L--N--D--T--R--D--T--E--T--K--L--K--G--S--Q--G--L--C--N--E--T--M--M--A--L--W--E--E--C--K

---------------------------------------------------------------------------><-----------------------
--P--C--L--K--Q--T--C--M--K--F--Y--A--R--V--C--R--S--G--S--G--L--V--G--R--Q--L--E--E--F--L--N--Q--S-
GCCCTGCCTGAAACAGACCTGCATGAAGTTCTACGCACGCGTCTGCAGAAGTGGCTCAGGCCTGGTTGGCCGCCAGCTTGAGGAGTTCCTGAACCAGAGC
::::::::::::::::::::::::::::::::::::.::.::::::::.::.:::::.:: ::::::::::.::::::.:::::::::::::::::::::
GCCCTGCCTGAAACAGACCTGCATGAAGTTCTACGCGCGTGTCTGCAGGAGCGGCTCGGGACTGGTTGGCCACCAGCTCGAGGAGTTCCTGAACCAGAGC
--P--C--L--K--Q--T--C--M--K--F--Y--A--R--V--C--R--S--G--S--G--L--V--G--H--Q--L--E--E--F--L--N--Q--S-

----------------------------------------------------------------------------------------------------
-S--P--F--Y--F--W--M--N--G--D--R--I--D--S--L--L--E--N--D--R--Q--Q--T--H--M--L--D--V--M--Q--D--H--F--
TCGCCCTTCTACTTCTGGATGAATGGTGACCGCATCGACTCCCTGCTGGAGAACGACCGGCAGCAGACGCACATGCTGGATGTCATGCAGGACCACTTCA
:: ::::::::::::::::: ::.::::::::::::::::::::: :::::::.::::: :::::::  :::.:: ::::..::::: ::::: .:::::
TCCCCCTTCTACTTCTGGATCAACGGTGACCGCATCGACTCCCTGATGGAGAATGACCGCCAGCAGAGCCACGTGATGGACATCATGGAGGACAGCTTCA
-S--P--F--Y--F--W--I--N--G--D--R--I--D--S--L--M--E--N--D--R--Q--Q--S--H--V--M--D--I--M--E--D--S--F--

----------------------------------------------------------------------------------------------------
S--R--A--S--S--I--I--D--E--L--F--Q--D--R--F--F--T--R--E--P--Q--D--T--Y--H--Y--L--P--F--S--L--P--H--R
GCCGCGCGTCCAGCATCATAGACGAGCTCTTCCAGGACAGGTTCTTCACCCGGGAGCCCCAGGATACCTACCACTACCTGCCCTTCAGCCTGCCCCACCG
.::: :::::::.:::.::.::.::::::::::::::: : :::::.: :::::::::..  ::.::..: . :: :...:::                 
ACCGGGCGTCCAACATTATGGATGAGCTCTTCCAGGACCGCTTCTTTAACCGGGAGCCTTTCGACACTCAGTTCTTCTCACCC-----------------
N--R--A--S--N--I--M--D--E--L--F--Q--D--R--F--F--N--R--E--P--F--D--T--Q--F--F--S--P------------------

----------------------------------------------------------------------------------------------------
--R--P--H--F--F--F--P--K--S--R--I--V--R--S--L--M--P--F--S--P--Y--E--P--L--N--F--H--A--M--F--Q--P--F-
GAGGCCTCACTTCTTCTTTCCCAAGTCCCGCATCGTCCGCAGCTTGATGCCCTTCTCTCCGTACGAGCCCCTGAACTTCCACGCCATGTTCCAGCCCTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------><-----------
-L--E--M--I--H--E--A--Q--Q--A--M--D--I--H--F--H--S--P--A--F--Q--H--P--P--T--E--F--I--R--E--G--D--D--
CTTGAGATGATACACGAGGCTCAGCAGGCCATGGACATCCACTTCCATAGCCCGGCCTTCCAGCACCCGCCAACAGAATTCATACGAGAAGGCGACGATG
                                                                                          ..:..:.:::
------------------------------------------------------------------------------------------AACAGCAATG
-------------------------------------------------------------------------------------------N--S--N--

--------------------------------------------------------------------------------------------><------
D--R--T--V--C--R--E--I--R--H--N--S--T--G--C--L--R--M--K--D--Q--C--D--K--C--R--E--I--L--S--V--D--C--S
ACCGGACTGTGTGCCGGGAGATCCGCCACAACTCCACGGGCTGCCTGCGGATGAAGGACCAGTGTGACAAGTGCCGGGAGATCTTGTCTGTGGACTGTTC
::::..:::::::: .:::::::::::::::::::::::: :::::: ::::::::::::::::::: :::::::::::::::::::: :::        
ACCGAGCTGTGTGCAAGGAGATCCGCCACAACTCCACGGGATGCCTGAGGATGAAGGACCAGTGTGAGAAGTGCCGGGAGATCTTGTCAGTG--------
D--R--A--V--C--K--E--I--R--H--N--S--T--G--C--L--R--M--K--D--Q--C--E--K--C--R--E--I--L--S--V---------

----------------------------------------------------------------------------------------------------
--T--N--N--P--S--Q--A--K--L--R--R--E--L--D--E--S--L--Q--V--A--E--R--L--T--R--K--Y--N--E--L--L--K--S-
CACCAACAACCCCTCCCAGGCTAAGCTGCGGCGGGAGCTCGACGAATCCCTCCAGGTCGCTGAGAGGTTGACCAGGAAATACAACGAGCTGCTAAAGTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Y--Q--W--K--M--L--N--T--S--S--L--L--E--Q--L--N--E--Q--F--N--W--V--S--R--L--A--N--L--T--Q--G--E--D--
TACCAGTGGAAGATGCTCAACACCTCCTCCTTGCTGGAGCAGCTGAACGAGCAGTTTAACTGGGTGTCCCGGCTGGCAAACCTCACGCAAGGCGAAGACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------><----------------------------------------------------------------------------
Q--Y--Y--L--R--V--T--T--V--A--S--H--T--S--D--S--D--V--P--S--G--V--T--E--V--V--V--K--L--F--D--S--D--P
AGTACTATCTGCGGGTCACCACGGTGGCTTCCCACACTTCTGACTCGGACGTTCCTTCCGGTGTCACTGAGGTGGTCGTGAAGCTCTTTGACTCTGATCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------><
--I--T--V--T--V--P--V--E--V--S--R--K--N--P--K--F--M--E--T--V--A--E--K--A--L--Q--E--Y--R--K--K--H--R-
CATCACTGTGACGGTCCCTGTAGAAGTCTCCAGGAAGAACCCTAAATTTATGGAGACCGTGGCGGAGAAAGCGCTGCAGGAATACCGCAAAAAGCACCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------->
-E--E--*-
GAGGAGTGA
         
---------
---------

Pig Consensus Sequence

>BGISUST0000879792
----------------------------------------------------------------------------------------------------
-----------------------------------------------------GGCGAGATGAAGACTCTGCTGCTCTTGGTGGGGCTGCTGCTGACCTG
GGAGAATGGCCCCTGGGTGCTGGGGGACAAGGCCATCTCGGACAAAGAGCTC---ATGTCCACCGAGGGGAGTAAGTACGTTAATAAAGAAATTAAAAAT
GCCCTCAAGGAGGTGAAACAGATAAAGACCCTAATAGAACAATCAAATGAAGAGCGCAAATCACTGCTCAGCTCCCTGGAGGAAGCCAAGAAGAAGAAAG
AGGATGCCCTGAACGATACCAGGGATACTGAGACAAAGCTGAAGGGATCCCAGGGCTTGTGCAATGAGACGATGATGGCCCTGTGGGAAGAGTGCAAGCC
CTGCCTGAAACAGACCTGCATGAAGTTCTACGCGCGTGTCTGCAGGAGCGGCTCGGGACTGGTTGGCCACCAGCTCGAGGAGTTCCTGAACCAGAGCTCC
CCCTTCTACTTCTGGATCAACGGTGACCGCATCGACTCCCTGATGGAGAATGACCGCCAGCAGAGCCACGTGATGGACATCATGGAGGACAGCTTCAACC
GGGCGTCCAACATTATGGATGAGCTCTTCCAGGACCGCTTCTTTAACCGGGAGCCTTTCGACACTCAGTTCTTCTCACCC--------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------AACAGCAATGACC
GAGCTGTGTGCAAGGAGATCCGCCACAACTCCACGGGATGCCTGAGGATGAAGGACCAGTGTGAGAAGTGCCGGGAGATCTTGTCAGTG-----------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------


>BGISUSP0000879792
---------------------------------------------------GEMKTLLLLVGLLLTWENGPWVLGDKAISDKEL-MSTEGSKYVNKEIKN
ALKEVKQIKTLIEQSNEERKSLLSSLEEAKKKKEDALNDTRDTETKLKGSQGLCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSS
PFYFWINGDRIDSLMENDRQQSHVMDIMEDSFNRASNIMDELFQDRFFNREPFDTQFFSP----------------------------------------
-----------------------------NSNDRAVCKEIRHNSTGCLRMKDQCEKCREILSV-------------------------------------
----------------------------------------------------------------------------------------------------
--