Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000179299 (click for geneview)
Transcript ID ENST00000316607(link to ensembl)
Symbol NP_078953.2
Localtion Chromosome:4:40592842:40652921:1 band: 4p14
Description hypothetical protein FLJ14001
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--L--N--S--T--G--E--L--E--F--S--N--E--E--D--P--E--I--I--S--Q--L--T--S--L--P--L--S--G--G--K--S--S--
ATGCTGAATTCCACGGGCGAACTGGAGTTTTCGAACGAAGAAGATCCCGAGATCATCTCCCAACTCACTTCCCTGCCTCTGTCCGGTGGGAAAAGCTCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--G--V--P--E--K--T--G--Y--P--D--S--V--Y--V-----M--A--A--N--I--F--Q--G--I--R--I--E--K--S--A--Q--K--V
CTGGTGTGCCCGAAAAAACGGGCTATCCGGACTCCGTTTATGTC---ATGGCAGCCAACATTTTTCAGGGTATTCGAATCGAAAAGTCGGCACAGAAAGT
  ::: :.: ::::::::: ::::::::::::::::::::..:.   :::::::: ::::::::::::::.:::::: .:::::::::. :: :::::::
--GGTTTACGCGAAAAAACTGGCTATCCGGACTCCGTTTACATTT--ATGGCAGCGAACATTTTTCAGGGCATTCGATCCGAAAAGTCACCAGAGAAAGT
---G--L--R--E--K--T--G--Y--P--D--S--V--Y--I--\--M--A--A--N--I--F--Q--G--I--R--S--E--K--S--P--E--K--V

----------------------------------------------------------------------------------------------------
--L--I--K--Y--G--N--E--P--L--R--S--L--S--E--S--E--D--Q--S--F--Q--R--L--S--Y--E--L--A--F--S--A--L--K-
CTTAATCAAGTATGGGAATGAACCCCTGCGGTCCTTGTCCGAGTCTGAGGATCAGTCCTTTCAGCGTTTGTCTTATGAGCTGGCTTTCAGTGCCCTGAAA
:::::: ::::::::::.::::::::::::::::::  :::::::::::::: :.:.::: :::::::::::.::.:::::::::::::::::::::   
CTTAATAAAGTATGGGAGTGAACCCCTGCGGTCCTTCACCGAGTCTGAGGATGAATTCTTACAGCGTTTGTCCTACGAGCTGGCTTTCAGTGCCCTG---
--L--I--K--Y--G--S--E--P--L--R--S--F--T--E--S--E--D--E--F--L--Q--R--L--S--Y--E--L--A--F--S--A--L----

><---------------------------------------------------------><---------------------------------------
-Y--Q--D--I--L--E--T--I--L--I--D--S--C--I--F--P--S--T--T--I--P--D--H--L--S--S--L--I--I--V--M--L--Y--
TATCAAGATATTTTGGAAACTATATTGATAGACAGCTGTATCTTCCCAAGTACCACAATACCAGATCATTTGAGCAGTCTTATTATTGTGATGCTATATG
   ::::::::::::::::::::.::.:::::.::::::::.::::::::::::::::::                           ::::::::.::::
---CAAGATATTTTGGAAACTATGTTAATAGATAGCTGTATTTTCCCAAGTACCACAATA---------------------------GTGATGCTGTATG
----Q--D--I--L--E--T--M--L--I--D--S--C--I--F--P--S--T--T--I-----------------------------V--M--L--Y--

------------------------------------------------------------------------------------------><--------
D--F--Q--D--R--K--F--Q--T--R--V--L--S--D--N--E--E--P--I--S--E--V--Q--E--V--E--N--L--L--N--S--F--K--I
ATTTCCAAGATAGAAAATTTCAAACTCGTGTCCTTTCTGATAATGAAGAGCCCATATCAGAAGTTCAAGAAGTAGAGAACCTTCTTAACAGTTTTAAGAT
::::::::::.::::::::::::.: ::: ::::::::::::::::::::...::: :.::::::: ::::::::::::::::::::::   : :::::.
ATTTCCAAGACAGAAAATTTCAAGCACGTCTCCTTTCTGATAATGAAGAGTTTATAGCGGAAGTTCTAGAAGTAGAGAACCTTCTTAAC---TATAAGAC
D--F--Q--D--R--K--F--Q--A--R--L--L--S--D--N--E--E--F--I--A--E--V--L--E--V--E--N--L--L--N-----Y--K--T

----------------------------------------------------------------------------------------------------
--K--L--A--A--A--L--A--R--C--R--I--K--H--D--A--L--S--I--Y--H--I--L--P--E--T--V--R--K--Q--E--L--R--A-
AAAATTGGCTGCAGCATTGGCAAGATGTCGAATCAAGCATGATGCCCTTTCAATTTACCACATCCTTCCAGAAACAGTTAGGAAACAGGAACTAAGGGCC
::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::: ::::::.::::::::
AAAATTGGCTGCAGCATTGGCAAGATGTCGAATCAAACATGATGCCCTTTCAATTTACCACATTCTTCCAGAAACAGTTAGGAACCAGGAATTAAGGGCC
--K--L--A--A--A--L--A--R--C--R--I--K--H--D--A--L--S--I--Y--H--I--L--P--E--T--V--R--N--Q--E--L--R--A-

-------------------------------------------><-------------------------------------------------------
-S--T--L--P--L--Y--A--W--I--N--T--C--K--I--S--P--E--E--V--Y--N--N--L--K--R--R--G--Y--N--K--V--K--S--
TCCACTTTACCACTTTATGCTTGGATAAATACTTGTAAAATCAGCCCTGAAGAAGTTTATAATAATTTGAAGAGAAGAGGCTATAATAAAGTCAAATCTG
::::::::.:::::::::::::::::::::::::::::::::   :.:::::::::::::::::.::::::::.::.:::::::::::::::::::::::
TCCACTTTGCCACTTTATGCTTGGATAAATACTTGTAAAATC---CTTGAAGAAGTTTATAATAGTTTGAAGAAAAAAGGCTATAATAAAGTCAAATCTG
-S--T--L--P--L--Y--A--W--I--N--T--C--K--I-----L--E--E--V--Y--N--S--L--K--K--K--G--Y--N--K--V--K--S--

----------------------------------------------------------------------------------------------------
V--L--H--I--D--D--K--V--F--A--V--D--Q--H--C--Y--D--V--L--I--F--P--S--H--L--K--N--D--L--I--N--I--D--L
TATTGCATATTGATGATAAAGTCTTTGCTGTGGATCAACATTGCTATGATGTCTTAATTTTTCCATCTCATCTTAAAAATGATCTTATAAATATAGATCT
::::::::::::::.:::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::: :::::::::::::
TATTGCATATTGATAATAAAGTCTTTGCTGTGGATCAACATTGCTATGATGTCATAATTTTTCCATCTCATCTTAAAAATGATCTTCTAAATATAGATCT
V--L--H--I--D--N--K--V--F--A--V--D--Q--H--C--Y--D--V--I--I--F--P--S--H--L--K--N--D--L--L--N--I--D--L

---------------------------><-----------------------------------------------------------------------
--F--K--D--Y--K--L--I--F--Q--D--K--S--R--S--L--A--V--H--S--V--K--A--L--L--N--M--D--D--D--V--L--M--V-
TTTCAAAGATTACAAACTTATATTTCAGGACAAATCTCGAAGTCTTGCTGTCCATTCTGTAAAGGCTTTATTAAATATGGATGATGATGTCTTAATGGTC
::::::::::::.::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::.:::::::::::
TTTCAAAGATTATAAACTTATATTTCAGGACAAATCTCGAAGTCTCGCTGTCCATTCTGTAAAGGCTTTATTAAATATGGATGATGATATCTTAATGGTC
--F--K--D--Y--K--L--I--F--Q--D--K--S--R--S--L--A--V--H--S--V--K--A--L--L--N--M--D--D--D--I--L--M--V-

----------------------------------------------------------------------------------------------------
-N--T--G--S--W--Y--T--V--S--H--M--S--I--L--T--N--N--N--T--S--K--V--F--V--C--G--V--Q--S--Q--A--K--D--
AATACAGGCTCATGGTACACAGTTTCCCACATGTCAATTTTAACAAATAATAATACCTCAAAAGTATTTGTGTGTGGAGTACAATCACAAGCTAAGGATC
:::::.::.::::::::::::::: ::::.::::::::.::::::::::::::::::::::::.:::::::.:::::.::::::::::::::::::::::
AATACGGGTTCATGGTACACAGTTGCCCATATGTCAATCTTAACAAATAATAATACCTCAAAAATATTTGTATGTGGGGTACAATCACAAGCTAAGGATC
-N--T--G--S--W--Y--T--V--A--H--M--S--I--L--T--N--N--N--T--S--K--I--F--V--C--G--V--Q--S--Q--A--K--D--

--------------------------------------><------------------------------------------------------------
P--D--L--K--T--L--F--T--K--I--G--C--K--N--I--E--I--L--H--E--K--F--I--N--I--E--S--K--D--H--R--L--Q--K
CTGACTTGAAGACCCTTTTCACAAAAATAGGATGTAAAAATATTGAAATACTTCATGAGAAATTTATTAACATTGAATCAAAGGATCACAGGTTACAGAA
:::::.::::::  ::::::::::::::.:::::::::   :::::::: :::::::::: .::::::::: ::::::::::::::::.::.::::::::
CTGACCTGAAGAAGCTTTTCACAAAAATGGGATGTAAA---ATTGAAATCCTTCATGAGACGTTTATTAACCTTGAATCAAAGGATCATAGATTACAGAA
P--D--L--K--K--L--F--T--K--M--G--C--K-----I--E--I--L--H--E--T--F--I--N--L--E--S--K--D--H--R--L--Q--K

----------------------------------------------------------------------------------><----------------
--V--K--V--I--L--L--L--P--R--C--S--G--L--G--V--S--N--P--V--E--F--I--L--N--E--H--E--D--T--E--F--L--K-
AGTTAAAGTGATTTTGCTGCTACCTCGTTGTTCAGGACTGGGTGTTAGTAATCCAGTAGAATTTATTTTAAATGAACATGAAGATACAGAATTCCTTAAA
:::::::::.:::.:.::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.::::::   ::::. :: ::::::
AGTTAAAGTAATTCTACTGCTACCTCGTTGTTCAGGGCTGGGTGTTAGTAATCCAGTAGAATTTATTTTAAATGAGCATGAA---ACAGGTTTACTTAAA
--V--K--V--I--L--L--L--P--R--C--S--G--L--G--V--S--N--P--V--E--F--I--L--N--E--H--E-----T--G--L--L--K-

------------------------------------------------------------------------------------><--------------
-D--H--S--Q--G--G--I--S--V--D--K--L--H--V--L--A--Q--Q--Q--Y--E--Q--L--T--H--A--M--K--F--T--K--A--Q--
GATCACTCTCAAGGAGGCATCTCAGTGGACAAACTTCACGTTCTTGCTCAACAGCAGTATGAACAGCTAACACATGCAATGAAATTTACTAAAGCTCAAG
:::. ::::::::::::::. :::: .::.::::::::.:::::::::::::::::.:::::::::::::::::::::::::::   ::::.::::::::
GATTTCTCTCAAGGAGGCACATCAGAAGATAAACTTCATGTTCTTGCTCAACAGCAATATGAACAGCTAACACATGCAATGAAA---ACTAGAGCTCAAG
-D--F--S--Q--G--G--T--S--E--D--K--L--H--V--L--A--Q--Q--Q--Y--E--Q--L--T--H--A--M--K-----T--R--A--Q--

----------------------------------------------------------------------------------------------------
A--V--V--Y--C--T--C--S--V--F--P--E--E--N--E--A--V--V--K--K--A--L--E--F--Q--D--L--G--N--K--G--Q--P--Y
CAGTTGTTTACTGCACATGTTCAGTTTTTCCAGAAGAAAATGAAGCTGTTGTTAAGAAAGCACTGGAATTTCAAGACCTTGGGAATAAAGGACAACCTTA
::::::::::.:::::::::::::::: ::::::::::::::::.:::::::::::::.:::::::::::::::::::.:::::.::::: ::::::.  
CAGTTGTTTATTGCACATGTTCAGTTTATCCAGAAGAAAATGAAACTGTTGTTAAGAAGGCACTGGAATTTCAAGACCCTGGGAGTAAAGTACAACCC--
A--V--V--Y--C--T--C--S--V--Y--P--E--E--N--E--T--V--V--K--K--A--L--E--F--Q--D--P--G--S--K--V--Q--P---

--><-------------------------->
--S--G--T--L--L--R--Q--C--L--*-
CAGCGGGACCCTTCTGAGACAGTGTCTGTGA
                               
-------------------------------
-------------------------------

Pig Consensus Sequence

>BGISUST0000901143
----------------------------------------------------------------------------------------------------
--GGTTTACGCGAAAAAACTGGCTATCCGGACTCCGTTTACATtaTGGCAGCGAACATTTTTCAGGGCATTCGATCCGAAAAGTCACCAGAGAAAGTCTT
AATAAAGTATGGGAGTGAACCCCTGCGGTCCTTCACCGAGTCTGAGGATGAATTCTTACAGCGTTTGTCCTACGAGCTGGCTTTCAGTGCCCTG------
CAAGATATTTTGGAAACTATGTTAATAGATAGCTGTATTTTCCCAAGTACCACAATA---------------------------GTGATGCTGTATGATT
TCCAAGACAGAAAATTTCAAGCACGTCTCCTTTCTGATAATGAAGAGTTTATAGCGGAAGTTCTAGAAGTAGAGAACCTTCTTAAC---TATAAGACAAA
ATTGGCTGCAGCATTGGCAAGATGTCGAATCAAACATGATGCCCTTTCAATTTACCACATTCTTCCAGAAACAGTTAGGAACCAGGAATTAAGGGCCTCC
ACTTTGCCACTTTATGCTTGGATAAATACTTGTAAAATC---CTTGAAGAAGTTTATAATAGTTTGAAGAAAAAAGGCTATAATAAAGTCAAATCTGTAT
TGCATATTGATAATAAAGTCTTTGCTGTGGATCAACATTGCTATGATGTCATAATTTTTCCATCTCATCTTAAAAATGATCTTCTAAATATAGATCTTTT
CAAAGATTATAAACTTATATTTCAGGACAAATCTCGAAGTCTCGCTGTCCATTCTGTAAAGGCTTTATTAAATATGGATGATGATATCTTAATGGTCAAT
ACGGGTTCATGGTACACAGTTGCCCATATGTCAATCTTAACAAATAATAATACCTCAAAAATATTTGTATGTGGGGTACAATCACAAGCTAAGGATCCTG
ACCTGAAGAAGCTTTTCACAAAAATGGGATGTAAA---ATTGAAATCCTTCATGAGACGTTTATTAACCTTGAATCAAAGGATCATAGATTACAGAAAGT
TAAAGTAATTCTACTGCTACCTCGTTGTTCAGGGCTGGGTGTTAGTAATCCAGTAGAATTTATTTTAAATGAGCATGAA---ACAGGTTTACTTAAAGAT
TTCTCTCAAGGAGGCACATCAGAAGATAAACTTCATGTTCTTGCTCAACAGCAATATGAACAGCTAACACATGCAATGAAA---ACTAGAGCTCAAGCAG
TTGTTTATTGCACATGTTCAGTTTATCCAGAAGAAAATGAAACTGTTGTTAAGAAGGCACTGGAATTTCAAGACCCTGGGAGTAAAGTACAACCC-----
----------------------------


>BGISUSP0000901143
----------------------------------GLREKTGYPDSVYIMAANIFQGIRSEKSPEKVLIKYGSEPLRSFTESEDEFLQRLSYELAFSAL--
QDILETMLIDSCIFPSTTI---------VMLYDFQDRKFQARLLSDNEEFIAEVLEVENLLN-YKTKLAAALARCRIKHDALSIYHILPETVRNQELRAS
TLPLYAWINTCKI-LEEVYNSLKKKGYNKVKSVLHIDNKVFAVDQHCYDVIIFPSHLKNDLLNIDLFKDYKLIFQDKSRSLAVHSVKALLNMDDDILMVN
TGSWYTVAHMSILTNNNTSKIFVCGVQSQAKDPDLKKLFTKMGCK-IEILHETFINLESKDHRLQKVKVILLLPRCSGLGVSNPVEFILNEHE-TGLLKD
FSQGGTSEDKLHVLAQQQYEQLTHAMK-TRAQAVVYCTCSVYPEENETVVKKALEFQDPGSKVQP-----------