Sequences
EST Library Info
cki1Kidney - RNA from China
pgl1Pituitary gland
Clusters
Oligos
SNPs

Gene ID ENSG00000176903 (click for geneview)
Transcript ID ENST00000316836(link to ensembl)
Symbol PNMA1_HUMAN
Localtion Chromosome:14:73249034:73250095:-1 band: 14q24.3
Description Paraneoplastic antigen Ma1 (Neuron- and testis-specific protein 1) (37 kDa neuronal protein).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--M--T--L--L--E--D--W--C--R--G--M--D--V--N--S--Q--R--A--L--L--V--W--G--I--P--V--N--C--D--E--A--
ATGGCGATGACACTGTTGGAAGACTGGTGCCGGGGGATGGATGTGAACTCCCAGAGAGCTCTGTTAGTCTGGGGCATCCCAGTGAACTGTGATGAGGCTG
:::::::::::::::.:::::::.:::::. ::::::::::::::::::::::::::::.:: .:.:::::::: ::::: :::::::::::::::.:.:
ATGGCGATGACACTGCTGGAAGATTGGTGTAGGGGGATGGATGTGAACTCCCAGAGAGCCCTTCTGGTCTGGGGGATCCCTGTGAACTGTGATGAGACCG
-M--A--M--T--L--L--E--D--W--C--R--G--M--D--V--N--S--Q--R--A--L--L--V--W--G--I--P--V--N--C--D--E--T--

----------------------------------------------------------------------------------------------------
E--I--E--E--T--L--Q--A--A--M--P--Q--V--S--Y--R--M--L--G--R--M--F--W--R--E--E--N--A--K--A--A--L--L--E
AAATCGAAGAGACCCTCCAGGCTGCGATGCCCCAGGTCTCCTACCGAATGCTTGGGAGAATGTTCTGGAGGGAAGAAAATGCGAAAGCAGCCTTATTAGA
::::::::::::::.:.::.::::::::::::::::: .::::.:::.::::::::::::::::::::::::::::.::::: :::::::::::.:::::
AAATCGAAGAGACCTTTCAAGCTGCGATGCCCCAGGTGCCCTATCGAGTGCTTGGGAGAATGTTCTGGAGGGAAGAGAATGCCAAAGCAGCCTTGTTAGA
E--I--E--E--T--F--Q--A--A--M--P--Q--V--P--Y--R--V--L--G--R--M--F--W--R--E--E--N--A--K--A--A--L--L--E

----------------------------------------------------------------------------------------------------
--L--T--G--A--V--D--Y--A--A--I--P--R--E--M--P--G--K--G--G--V--W--K--V--L--F--K--P--P--T--S--D--A--E-
GCTCACTGGCGCTGTAGATTACGCCGCGATCCCCAGGGAGATGCCGGGCAAAGGAGGGGTCTGGAAAGTGTTATTTAAGCCCCCAACTTCTGATGCTGAA
:::::::::.::::: :::::.::.::::::::::::::::::::.::.::::::::::::::::::::. : ::::::::::: :::::.:::::::::
GCTCACTGGTGCTGTCGATTATGCTGCGATCCCCAGGGAGATGCCAGGTAAAGGAGGGGTCTGGAAAGTAGTCTTTAAGCCCCCCACTTCCGATGCTGAA
--L--T--G--A--V--D--Y--A--A--I--P--R--E--M--P--G--K--G--G--V--W--K--V--V--F--K--P--P--T--S--D--A--E-

----------------------------------------------------------------------------------------------------
-F--L--E--R--L--H--L--F--L--A--R--E--G--W--T--V--Q--D--V--A--R--V--L--G--F--Q--N--P--T--P--T--P--G--
TTTTTAGAAAGATTGCACCTCTTCCTAGCTAGAGAGGGGTGGACCGTGCAAGATGTTGCCCGTGTCCTTGGGTTTCAGAACCCTACTCCGACCCCGGGCC
:::::::::::.::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::.::::.::::
TTTTTAGAAAGGTTGCACCTCTTCCTAGCAAGAGAGGGGTGGACCGTGCAAGATGTTGCCCGTGTCCTTGGGTTTCAGAACCCCACTCCGGCCCCAGGCC
-F--L--E--R--L--H--L--F--L--A--R--E--G--W--T--V--Q--D--V--A--R--V--L--G--F--Q--N--P--T--P--A--P--G--

----------------------------------------------------------------------------------------------------
P--E--M--P--A--E--M--L--N--Y--I--L--D--N--V--I--Q--P--L--V--E--S--I--W--Y--K--R--L--T--L--F--S--G--R
CAGAGATGCCAGCAGAGATGCTAAACTATATTTTGGATAATGTTATTCAGCCTCTTGTTGAGTCCATATGGTACAAGAGGCTGACACTTTTCTCGGGGAG
: ::.:::::.:::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::.::::::..: ::::::::.::
CCGAAATGCCGGCAGAGATGCTAAACTATATTTTGGATAATGTTATTCAGCCTCTGGTTGAGTCCATATGGTACAAGAAGCTGACGTTGTTCTCGGGAAG
P--E--M--P--A--E--M--L--N--Y--I--L--D--N--V--I--Q--P--L--V--E--S--I--W--Y--K--K--L--T--L--F--S--G--R

----------------------------------------------------------------------------------------------------
--D--I--P--G--P--G--E--E--T--F--D--P--W--L--E--H--T--N--E--V--L--E--E--W--Q--V--S--D--V--E--K--R--R-
GGACATCCCAGGGCCTGGAGAGGAAACCTTTGATCCCTGGCTGGAGCACACTAATGAGGTCCTAGAGGAGTGGCAGGTGTCCGATGTAGAAAAGAGGCGG
::::::.::.::::: ::.:::::..: ::::::::::::::::::::::::::::::::: :::::::::::::::::.:.::::::::::::::::::
GGACATTCCGGGGCCAGGGGAGGAGGCATTTGATCCCTGGCTGGAGCACACTAATGAGGTCATAGAGGAGTGGCAGGTGCCTGATGTAGAAAAGAGGCGG
--D--I--P--G--P--G--E--E--A--F--D--P--W--L--E--H--T--N--E--V--I--E--E--W--Q--V--P--D--V--E--K--R--R-

----------------------------------------------------------------------------------------------------
-R--L--M--E--S--L--R--G--P--A--A--D--V--I--R--I--L--K--S--N--N--P--A--I--T--T--A--E--C--L--K--A--L--
CGGTTGATGGAGAGTCTTAGAGGCCCCGCCGCTGATGTTATTCGCATCCTTAAGTCCAACAACCCCGCGATAACCACTGCCGAATGCCTGAAGGCGCTTG
::::::::::::::.:::::::::::.:::::::::::.::.::::::::.::: ::::::::::.::::: :::::.::.::::::::::::::::: :
CGGTTGATGGAGAGCCTTAGAGGCCCTGCCGCTGATGTCATCCGCATCCTCAAGACCAACAACCCTGCGATTACCACCGCTGAATGCCTGAAGGCGCTGG
-R--L--M--E--S--L--R--G--P--A--A--D--V--I--R--I--L--K--T--N--N--P--A--I--T--T--A--E--C--L--K--A--L--

----------------------------------------------------------------------------------------------------
E--Q--V--F--G--S--V--E--S--S--R--D--A--Q--I--K--F--L--N--T--Y--Q--N--P--G--E--K--L--S--A--Y--V--I--R
AGCAGGTGTTTGGGAGCGTTGAGAGCTCTAGGGATGCCCAGATCAAATTTCTGAACACTTATCAGAACCCGGGAGAAAAATTGTCTGCTTATGTCATTCG
:::::::::::::::::::.::::::::::::::::: :::.: :.:::::::::::: ::.::::::::::::::::::::.::::::::::: :::::
AGCAGGTGTTTGGGAGCGTCGAGAGCTCTAGGGATGCGCAGGTGAGATTTCTGAACACATACCAGAACCCGGGAGAAAAATTATCTGCTTATGTGATTCG
E--Q--V--F--G--S--V--E--S--S--R--D--A--Q--V--R--F--L--N--T--Y--Q--N--P--G--E--K--L--S--A--Y--V--I--R

----------------------------------------------------------------------------------------------------
--L--E--P--L--L--Q--K--V--V--E--K--G--A--I--D--K--D--N--V--N--Q--A--R--L--E--Q--V--I--A--G--A--N--H-
TCTGGAGCCTCTGCTACAGAAGGTGGTAGAGAAGGGGGCCATTGATAAAGATAATGTGAACCAGGCCCGCCTAGAGCAGGTCATTGCCGGGGCCAACCAC
:::::::::::::::.::::::::::: :::::::::::::: :::::::::::.:::::::::::::::::.:::::::::::::::::::::::.:::
TCTGGAGCCTCTGCTGCAGAAGGTGGTTGAGAAGGGGGCCATAGATAAAGATAACGTGAACCAGGCCCGCCTGGAGCAGGTCATTGCCGGGGCCAATCAC
--L--E--P--L--L--Q--K--V--V--E--K--G--A--I--D--K--D--N--V--N--Q--A--R--L--E--Q--V--I--A--G--A--N--H-

----------------------------------------------------------------------------------------------------
-S--G--A--I--R--R--Q--L--W--L--T--G--A--G--E--G--P--A--P--N--L--F--Q--L--L--V--Q--I--R--E--E--E--A--
AGCGGGGCCATCCGAAGGCAGCTGTGGCTTACCGGGGCTGGGGAAGGGCCAGCCCCAAACCTCTTTCAGTTGCTGGTGCAGATCCGTGAGGAGGAAGCCA
:::::.:::::::::::::::.::::::: ::::::::::  ::::::::.::::: ::::::::.::::::::::::::::::::.::::::::.::::
AGCGGAGCCATCCGAAGGCAGTTGTGGCTGACCGGGGCTGCTGAAGGGCCGGCCCCCAACCTCTTCCAGTTGCTGGTGCAGATCCGCGAGGAGGAGGCCA
-S--G--A--I--R--R--Q--L--W--L--T--G--A--A--E--G--P--A--P--N--L--F--Q--L--L--V--Q--I--R--E--E--E--A--

------------------------------------------------------------->
K--E--E--E--E--E--A--E--A--T--L--L--Q--L--G--L--E--G--H--F--*-
AGGAGGAGGAGGAGGAGGCTGAGGCCACCCTTCTGCAGTTAGGCCTGGAAGGGCACTTCTGA
::::.:::::::::::::::::::::.::::.:::::::::::::::::.::::::::::::
AGGAAGAGGAGGAGGAGGCTGAGGCCGCCCTCCTGCAGTTAGGCCTGGAGGGGCACTTCTGA
K--E--E--E--E--E--A--E--A--A--L--L--Q--L--G--L--E--G--H--F--*-

Pig Consensus Sequence

>BGISUST0000885545
ATGGCGATGACACTGCTGGAAGATTGGTGTAGGGGGATGGATGTGAACTCCCAGAGAGCCCTTCTGGTCTGGGGGATCCCTGTGAACTGTGATGAGACCG
AAATCGAAGAGACCTTTCAAGCTGCGATGCCCCAGGTGCCCTATCGAGTGCTTGGGAGAATGTTCTGGAGGGAAGAGAATGCCAAAGCAGCCTTGTTAGA
GCTCACTGGTGCTGTCGATTATGCTGCGATCCCCAGGGAGATGCCAGGTAAAGGAGGGGTCTGGAAAGTAGTCTTTAAGCCCCCCACTTCCGATGCTGAA
TTTTTAGAAAGGTTGCACCTCTTCCTAGCAAGAGAGGGGTGGACCGTGCAAGATGTTGCCCGTGTCCTTGGGTTTCAGAACCCCACTCCGGCCCCAGGCC
CCGAAATGCCGGCAGAGATGCTAAACTATATTTTGGATAATGTTATTCAGCCTCTGGTTGAGTCCATATGGTACAAGAAGCTGACGTTGTTCTCGGGAAG
GGACATTCCGGGGCCAGGGGAGGAGGCATTTGATCCCTGGCTGGAGCACACTAATGAGGTCATAGAGGAGTGGCAGGTGCCTGATGTAGAAAAGAGGCGG
CGGTTGATGGAGAGCCTTAGAGGCCCTGCCGCTGATGTCATCCGCATCCTCAAGACCAACAACCCTGCGATTACCACCGCTGAATGCCTGAAGGCGCTGG
AGCAGGTGTTTGGGAGCGTCGAGAGCTCTAGGGATGCGCAGGTGAGATTTCTGAACACATACCAGAACCCGGGAGAAAAATTATCTGCTTATGTGATTCG
TCTGGAGCCTCTGCTGCAGAAGGTGGTTGAGAAGGGGGCCATAGATAAAGATAACGTGAACCAGGCCCGCCTGGAGCAGGTCATTGCCGGGGCCAATCAC
AGCGGAGCCATCCGAAGGCAGTTGTGGCTGACCGGGGCTGCTGAAGGGCCGGCCCCCAACCTCTTCCAGTTGCTGGTGCAGATCCGCGAGGAGGAGGCCA
AGGAAGAGGAGGAGGAGGCTGAGGCCGCCCTCCTGCAGTTAGGCCTGGAGGGGCACTTCTGA


>BGISUSP0000885545
MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDETEIEETFQAAMPQVPYRVLGRMFWREENAKAALLELTGAVDYAAIPREMPGKGGVWKVVFKPPTSDAE
FLERLHLFLAREGWTVQDVARVLGFQNPTPAPGPEMPAEMLNYILDNVIQPLVESIWYKKLTLFSGRDIPGPGEEAFDPWLEHTNEVIEEWQVPDVEKRR
RLMESLRGPAADVIRILKTNNPAITTAECLKALEQVFGSVESSRDAQVRFLNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH
SGAIRRQLWLTGAAEGPAPNLFQLLVQIREEEAKEEEEEAEAALLQLGLEGHF*