Sequences
EST Library Info
cje3Jejunum - RNA from China
cki2Kidney - RNA from China
eje4Foetus 50 days, jejunum
jej9Small intestine, jejunum
nco9Newborn 115 days, colon
pgl3Pituitary gland
plac2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000181885 (click for geneview)
Transcript ID ENST00000317838(link to ensembl)
Symbol CLDN7
Localtion Chromosome:17:7104184:7106513:-1 band: 17p13.1
Description Claudin-7 (CLDN-7). [Source:Uniprot/SWISSPROT;Acc:O95471]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--N--S--G--L--Q--L--L--G--F--S--M--A--L--L--G--W--V--G--L--V--A--C--T--A--I--P--Q--W--Q--M--S--
ATGGCCAATTCGGGCCTGCAGTTGCTGGGCTTCTCCATGGCCCTGCTGGGCTGGGTGGGTCTGGTGGCCTGCACCGCCATCCCGCAGTGGCAGATGAGCT
::::::::.:: ::::::::..::::::::::.::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::::::::::
ATGGCCAACTCCGGCCTGCAACTGCTGGGCTTTTCCATGGCTCTGCTGGGCTGGGTGGGCCTGGTGGCCTGCACCGCCATCCCGCAGTGGCAGATGAGCT
-M--A--N--S--G--L--Q--L--L--G--F--S--M--A--L--L--G--W--V--G--L--V--A--C--T--A--I--P--Q--W--Q--M--S--

----------------------------------------------------------------------------------------------------
S--Y--A--G--D--N--I--I--T--A--Q--A--M--Y--K--G--L--W--M--D--C--V--T--Q--S--T--G--M--M--S--C--K--M--Y
CCTATGCGGGTGACAACATCATCACGGCCCAGGCCATGTACAAGGGGCTGTGGATGGACTGCGTCACGCAGAGCACGGGGATGATGAGCTGCAAAATGTA
: ::.::::: ::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::.:: ::::::::::::::::.:::
CGTACGCGGGGGACAACATCATCACGGCCCAGGCCATGTACAAGGGGCTATGGATGGACTGCGTCACGCAGAGCACAGGCATGATGAGCTGCAAAACGTA
S--Y--A--G--D--N--I--I--T--A--Q--A--M--Y--K--G--L--W--M--D--C--V--T--Q--S--T--G--M--M--S--C--K--T--Y

----------------------><----------------------------------------------------------------------------
--D--S--V--L--A--L--S--A--A--L--Q--A--T--R--A--L--M--V--V--S--L--V--L--G--F--L--A--M--F--V--A--T--M-
CGACTCGGTGCTCGCCCTGTCCGCGGCCTTGCAGGCCACTCGAGCCCTAATGGTGGTCTCCCTGGTGCTGGGCTTCCTGGCCATGTTTGTGGCCACGATG
::::::::::::::::::::::   :::.::::.:::::.::::::::::::::::::::::::::::::::.::  ::::::::::.::::  :: :::
CGACTCGGTGCTCGCCCTGTCC---GCCCTGCAAGCCACCCGAGCCCTAATGGTGGTCTCCCTGGTGCTGGGTTTGATGGCCATGTTCGTGGGAACCATG
--D--S--V--L--A--L--S-----A--L--Q--A--T--R--A--L--M--V--V--S--L--V--L--G--L--M--A--M--F--V--G--T--M-

---------------------------------------------------------------------------------------><-----------
-G--M--K--C--T--R--C--G--G--D--D--K--V--K--K--A--R--I--A--M--G--G--G--I--I--F--I--V--A--G--L--A--A--
GGCATGAAGTGCACGCGCTGTGGGGGAGACGACAAAGTGAAGAAGGCCCGTATAGCCATGGGTGGAGGCATAATTTTCATCGTGGCAGGTCTTGCCGCCT
:::::::::::.::. .:::::::::::::::::::::::::::.:::::::::::::::. ::::::::: :::::::::::::::   :::  .:: :
GGCATGAAGTGTACAAACTGTGGGGGAGACGACAAAGTGAAGAAAGCCCGTATAGCCATGACTGGAGGCATCATTTTCATCGTGGCA---CTTTGTGCGT
-G--M--K--C--T--N--C--G--G--D--D--K--V--K--K--A--R--I--A--M--T--G--G--I--I--F--I--V--A-----L--C--A--

------------------------------------------------------------------------><--------------------------
L--V--A--C--S--W--Y--G--H--Q--I--V--T--D--F--Y--N--P--L--I--P--T--N--I--K--Y--E--F--G--P--A--I--F--I
TGGTAGCTTGCTCCTGGTATGGCCATCAGATTGTCACAGACTTTTATAACCCTTTGATCCCTACCAACATTAAGTATGAGTTTGGCCCTGCCATCTTTAT
::.::::::::::::::::::::::.:::::::::::::::::::::::::: :::.::::.:: :::      :::::::::::::::::::::::.::
TGATAGCTTGCTCCTGGTATGGCCACCAGATTGTCACAGACTTTTATAACCCGTTGGTCCCCACAAAC------TATGAGTTTGGCCCTGCCATCTTCAT
L--I--A--C--S--W--Y--G--H--Q--I--V--T--D--F--Y--N--P--L--V--P--T--N--------Y--E--F--G--P--A--I--F--I

----------------------------------------------------------------------------------------------------
--G--W--A--G--S--A--L--V--I--L--G--G--A--L--L--S--C--S--C--P--G--N--E--S--K--A--G--Y--R--V--P--R--S-
TGGCTGGGCAGGGTCTGCCCTAGTCATCCTGGGAGGTGCACTGCTCTCCTGTTCCTGTCCTGGGAATGAGAGCAAGGCTGGGTACCGTGTACCCCGCTCT
:::::::::::::::. :.::.::: :::::::::::::.::::::::.::.::.::::::::::.::::.:: :. ::::::::::::.:::::::::.
TGGCTGGGCAGGGTCCTCTCTGGTCCTCCTGGGAGGTGCGCTGCTCTCTTGCTCTTGTCCTGGGAGTGAGGGCCAATCTGGGTACCGTGCACCCCGCTCC
--G--W--A--G--S--S--L--V--L--L--G--G--A--L--L--S--C--S--C--P--G--S--E--G--Q--S--G--Y--R--A--P--R--S-

----------------------------------->
-Y--P--K--S--N--S--S--K--E--Y--V--*-
TACCCTAAGTCCAACTCTTCCAAGGAGTATGTGTGA
:::::::::.::::.::: ::::::::::.::::::
TACCCTAAGCCCAATTCTGCCAAGGAGTACGTGTGA
-Y--P--K--P--N--S--A--K--E--Y--V--*-

Pig Consensus Sequence

>BGISUST0000878435
ATGGCCAACTCCGGCCTGCAACTGCTGGGCTTTTCCATGGCTCTGCTGGGCTGGGTGGGCCTGGTGGCCTGCACCGCCATCCCGCAGTGGCAGATGAGCT
CGTACGCGGGGGACAACATCATCACGGCCCAGGCCATGTACAAGGGGCTATGGATGGACTGCGTCACGCAGAGCACAGGCATGATGAGCTGCAAAACGTA
CGACTCGGTGCTCGCCCTGTCC---GCCCTGCAAGCCACCCGAGCCCTAATGGTGGTCTCCCTGGTGCTGGGTTTGATGGCCATGTTCGTGGGAACCATG
GGCATGAAGTGTACAAACTGTGGGGGAGACGACAAAGTGAAGAAAGCCCGTATAGCCATGACTGGAGGCATCATTTTCATCGTGGCA---CTTTGTGCGT
TGATAGCTTGCTCCTGGTATGGCCACCAGATTGTCACAGACTTTTATAACCCGTTGGTCCCCACAAAC------TATGAGTTTGGCCCTGCCATCTTCAT
TGGCTGGGCAGGGTCCTCTCTGGTCCTCCTGGGAGGTGCGCTGCTCTCTTGCTCTTGTCCTGGGAGTGAGGGCCAATCTGGGTACCGTGCACCCCGCTCC
TACCCTAAGCCCAATTCTGCCAAGGAGTACGTGTGA


>BGISUSP0000878435
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKTYDSVLALS-ALQATRALMVVSLVLGLMAMFVGTM
GMKCTNCGGDDKVKKARIAMTGGIIFIVA-LCALIACSWYGHQIVTDFYNPLVPTN--YEFGPAIFIGWAGSSLVLLGGALLSCSCPGSEGQSGYRAPRS
YPKPNSAKEYV*