Sequences
EST Library Info
aor2Aorta
cad1Unavailable
che1Heart - RNA from China
cje4Jejunum - RNA from China
cki1Kidney - RNA from China
cmu1Rhinal mucous membrane - RNA from China
csk1Skin - RNA from China
cst1Stomach - RNA from China
ebs2Foetus 50 days, brain stem
ecc2Foetus 50 days, cortex cerebri
ece2Foetus 50 days, cerebellum
eru1Foetus 50 days, regio umbilicalis
ese1Foetus 50 days, M. semitendinosus
fcc1Unavailable
fce3Foetus 100 days, cerebellum
hlv3Heart, left ventricle
med3Mediastinum
nca1Newborn 115 days, cartillage
nco1Newborn 115 days, colon
nmm3Newborn 115 days, mucosal membranes
nms1Newborn 115 days, M. semitendinosus
pgl1Pituitary gland
sto2Stomach
ton1Tip of tongue, mucosal membrane
uio2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000140264 (click for geneview)
Transcript ID ENST00000317879(link to ensembl)
Symbol NP_057484.3
Localtion Chromosome:15:41871844:41881362:1 band: 15q15.3
Description Huntingtin interacting protein K
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------><-----------------------------------------------------------------
-M--T--G--F--L--L--P--P--A--S--R--A--S--R--T--G--A-----E--R--R--C--G--P--G--P--A--P--P--P--P--R--A--
ATGACGGGCTTTCTGCTGCCGCCCGCAAGCAGAGCTTCTAGAACTGGAGCA---GAAAGAAGGTGTGGCCCAGGGCCAGCCCCGCCTCCTCCCCGGGCGG
:::::::::::::::::::::::::::::::::   ::::::::..:::::    :::::::::::::.:::::: :::::::::::::::.::::::::
ATGACGGGCTTTCTGCTGCCGCCCGCAAGCAGA---TCTAGAACCAGAGCAC--TAAAGAAGGTGTGGTCCAGGGGCAGCCCCGCCTCCTCTCCGGGCGG
-M--T--G--F--L--L--P--P--A--S--R-----S--R--T--R--A--\--Q--R--R--C--G--P--G--A--A--P--P--P--L--R--A--

----------------------------------------------------------------------------------------------------
E-----A--V--S--V--A--G--S--R--R--E--V--G--------L--M--R--R--R--G--E--I--D--M--A--T--E--G--D--V--E--L
AA---GCTGTGTCAGTTGCCGGAAGTCGGCGTGAGGTGGGG------CTTATGCGGCGGCGTGGTGAAATAGATATGGCGACCGAGGGGGATGTGGAGCT
::   :: :   :::::.:::::::::  :.:::::.::::      :: : : : :::::.::::..:: :: ::::::::::::::::::::::::::
AAGTTGCGGG-GCAGTTACCGGAAGTCCTCATGAGGCGGGGCCGGGCCTGAGGGG-CGGCGCGGTGGGATCGAAATGGCGACCGAGGGGGATGTGGAGCT
E--V--A--V--A--V--T--G--S--P--H--E--A--G--P--G--L--R--R--R--R--G--G--I--E--M--A--T--E--G--D--V--E--L

----------------------------------------------------------------------------------------------------
--E--L--E--T--E--T--S--G--P--E--R--P--P--E--K--P--R--K--H--D--S--G--A--A--D--L--E--R--V--T--D--Y--A-
GGAGTTGGAGACTGAGACCAGTGGACCAGAGCGGCCTCCGGAGAAGCCACGGAAACATGACAGCGGTGCGGCGGACTTGGAGCGGGTCACCGACTATGCA
.::.:::::::::::::::::::: ::.:::::.::::: ::::::::::::::.::.::::::::::::::::::::::::::.::::::::.:::::.
AGAATTGGAGACTGAGACCAGTGGCCCGGAGCGACCTCCCGAGAAGCCACGGAAGCACGACAGCGGTGCGGCGGACTTGGAGCGAGTCACCGATTATGCG
--E--L--E--T--E--T--S--G--P--E--R--P--P--E--K--P--R--K--H--D--S--G--A--A--D--L--E--R--V--T--D--Y--A-

-----------------------------------------><------------------------------------------------------><-
-E--E--K--E--I--Q--S--S--N--L--E--T--A--M--S--V--I--G--D--R--R--S--R--E--Q--K--A--K--Q--E--R--E--K--
GAGGAGAAGGAGATCCAGAGTTCCAATCTGGAGACGGCCATGTCTGTGATTGGAGACAGAAGGTCCCGGGAGCAGAAAGCCAAACAGGAGCGGGAGAAAG
::::::::::::::::::::::::::::::::::::::::::::.::.::.:::::.::: ::::::::::::::::::: ::.::::::   :::::::
GAGGAGAAGGAGATCCAGAGTTCCAATCTGGAGACGGCCATGTCCGTAATCGGAGATAGACGGTCCCGGGAGCAGAAAGCAAAGCAGGAG---GAGAAAG
-E--E--K--E--I--Q--S--S--N--L--E--T--A--M--S--V--I--G--D--R--R--S--R--E--Q--K--A--K--Q--E-----E--K--

-------------------------------------------------><-------------------------------------------------
E--L--A--K--V--T--I--K--K--E--D--L--E--L--I--M--T--E--M--E--I--S--R--A--A--A--E--R--S--L--R--E--H--M
AACTGGCAAAAGTCACTATCAAGAAGGAAGATCTGGAGCTAATAATGACTGAGATGGAGATATCTCGAGCAGCAGCAGAACGCAGTTTGCGGGAACACAT
::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::: :::::::::::::::::::: :::::: :.::::::::
AACTGGCAAAAGTCACTATCAAGAAGGAAGATCTGGAGCTAATAATGACAGAGATGGAGATCTCTCGAGCAGCAGCAGAACGGAGTTTGAGAGAACACAT
E--L--A--K--V--T--I--K--K--E--D--L--E--L--I--M--T--E--M--E--I--S--R--A--A--A--E--R--S--L--R--E--H--M

----------------------------------------
--G--N--V--V--E--A--L--I--A--L--T--N--*-
GGGCAACGTGGTAGAGGCGCTTATTGCCCTAACCAACTGA
:::::::::::::::::: :::::::::::.:::::::::
GGGCAACGTGGTAGAGGCTCTTATTGCCCTGACCAACTGA
--G--N--V--V--E--A--L--I--A--L--T--N--*-

Pig Consensus Sequence

>BGISUST0000898985
ATGACGGGCTTTCTGCTGCCGCCCGCAAGCAGA---TCTAGAACCAGAGCatAAAGAAGGTGTGGTCCAGGGGCAGCCCCGCCTCCTCTCCGGGCGGAAG
TtgGGGCAGTTACCGGAAGTCCTCATGAGGCGGGGCCgcCTGAGGGGCGGCGCGGTGGGATCGAAATGGCGACCGAGGGGGATGTGGAGCTAGAATTGGA
GACTGAGACCAGTGGCCCGGAGCGACCTCCCGAGAAGCCACGGAAGCACGACAGCGGTGCGGCGGACTTGGAGCGAGTCACCGATTATGCGGAGGAGAAG
GAGATCCAGAGTTCCAATGCCATGTCCGTAATCGGAGATAGACGGTCCCGGGAGCAGAAAGCAAAGCAGGAG---GAGAAAGAACTGGCAAAAGTCACTA
TCAAGAAGGAAGATCTGGAGCTAATAATGACAGAGATGGAGATCTCTCGAGCAGCAGCAGAACGGAGTTTGAGAGAACACATGGGCAACGTGGTAGAGGC
TCTTATTGCCCTGACCAACTGA


>BGISUSP0000898985
MTGFLLPPASR-SRTRA*RRCGPGAAPPPLRAEVGAVTGSPHEAGPPEGRRGGIEMATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEK
EIQSSNAMSVIGDRRSREQKAKQE-EKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALTN*