Sequences
EST Library Info
cad1Unavailable
cly1Lymph - RNA from China
csp2Spleen - RNA from China
jca1Joint capsule
lnt2Lymphatic nodule tracheobroncalis
nco2Newborn 115 days, colon
nje2Newborn 115 days, jejunum
pigcb6Unavailable
rec1Rectum
Clusters
Oligos
SNPs

Gene ID ENSG00000163687 (click for geneview)
Transcript ID ENST00000318316(link to ensembl)
Symbol DNASE1L3
Localtion Chromosome:3:58153454:58175893:-1 band: 3p14.3
Description Deoxyribonuclease gamma precursor (EC 3.1.21.-) (DNase gamma) (Deoxyribonuclease I-like 3) (DNase I homolog protein DHP2) (Liver and spleen DNase) (LS-DNase) (LSD). [Source:Uniprot/SWISSPROT;Acc:Q13609]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--R--E--L--A--P--L--L--L--L--L--L--S--I--H--S--A--L--A--M--R--I--C--S--F--N--V--R--S--F--G--E--
ATGTCACGGGAGCTGGCCCCACTGCTGCTTCTCCTCCTCTCCATCCACAGCGCCCTGGCCATGAGGATCTGCTCCTTCAACGTCAGGTCCTTTGGGGAAA
::::: :.:  :::::.:.: ::: ::::::::::::::::::.::::::. :::::::: :::::::::::::::::::.:: ::::::::::::::: 
ATGTCTCAGCTGCTGGTCTCCCTGATGCTTCTCCTCCTCTCCACCCACAGTTCCCTGGCCCTGAGGATCTGCTCCTTCAATGTGAGGTCCTTTGGGGAAT
-M--S--Q--L--L--V--S--L--M--L--L--L--L--S--T--H--S--S--L--A--L--R--I--C--S--F--N--V--R--S--F--G--E--

----------------------------------------><----------------------------------------------------------
S--K--Q--E--D--K--N--A--M--D--V--I--V--K--V--I--K--R--C--D--I--I--L--V--M--E--I--K--D--S--N--N--R--I
GCAAGCAGGAAGACAAGAATGCCATGGATGTCATTGTGAAGGTCATCAAACGCTGTGACATCATACTCGTGATGGAAATCAAGGACAGCAACAACAGGAT
 :::: ::: :.:: . :::::::::::::::::.::::::::::::::::::::.:::::::::::: ::::::::::::::::::::::::::: :::
CCAAGAAGGCAAACTGTAATGCCATGGATGTCATCGTGAAGGTCATCAAACGCTGCGACATCATACTCCTGATGGAAATCAAGGACAGCAACAACATGAT
S--K--K--A--N--C--N--A--M--D--V--I--V--K--V--I--K--R--C--D--I--I--L--L--M--E--I--K--D--S--N--N--M--I

-----------------------------><---------------------------------------------------------------------
--C--P--I--L--M--E--K--L--N--R--N--S--R--R--G--I--T--Y--N--Y--V--I--S--S--R--L--G--R--N--T--Y--K--E-
CTGCCCCATACTGATGGAGAAGCTGAACAGAAATTCAAGGAGAGGCATAACGTACAACTATGTGATTAGCTCTCGGCTTGGAAGAAACACATATAAAGAA
:::.::::..:::::::::::::::      ::::::::.:::.::.::::.::.::::::::::::::.::::::::::::::::::::::::::::::
CTGTCCCACGCTGATGGAGAAGCTG------AATTCAAGAAGAAGCGTAACATATAACTATGTGATTAGTTCTCGGCTTGGAAGAAACACATATAAAGAA
--C--P--T--L--M--E--K--L--------N--S--R--R--S--V--T--Y--N--Y--V--I--S--S--R--L--G--R--N--T--Y--K--E-

-------------------><-------------------------------------------------------------------------------
-Q--Y--A--F--L--Y--K--E--K--L--V--S--V--K--R--S--Y--H--Y--H--D--Y--Q--D--G--D--A--D--V--F--S--R--E--
CAATATGCCTTTCTCTACAAGGAAAAGCTGGTGTCTGTGAAGAGGAGTTATCACTACCATGACTATCAGGATGGAGACGCAGATGTGTTTTCCAGGGAGC
::.:::::::::::::::   ::::::::.:::::::::::::..::.:::: ::::::::::::::::  :::::::::::::::.:::::::::::.:
CAGTATGCCTTTCTCTAC---GAAAAGCTAGTGTCTGTGAAGAAAAGCTATCTCTACCATGACTATCAGTCTGGAGACGCAGATGTATTTTCCAGGGAAC
-Q--Y--A--F--L--Y-----E--K--L--V--S--V--K--K--S--Y--L--Y--H--D--Y--Q--S--G--D--A--D--V--F--S--R--E--

--------------------------------><------------------------------------------------------------------
P--F--V--V--W--F--Q--S--P--H--T--A--V--K--D--F--V--I--I--P--L--H--T--T--P--E--T--S--V--K--E--I--D--E
CCTTTGTGGTCTGGTTCCAATCTCCCCACACTGCTGTCAAAGACTTCGTGATTATCCCCCTGCACACCACCCCAGAGACATCCGTTAAGGAGATCGATGA
:::::::::::::::::::.:: :::.:::::   ::.::.:::::::::::.:::::::::::::::::::: ::::::::::::::.:::::.:::::
CCTTTGTGGTCTGGTTCCAGTCACCCTACACT---GTTAAGGACTTCGTGATCATCCCCCTGCACACCACCCCTGAGACATCCGTTAAAGAGATTGATGA
P--F--V--V--W--F--Q--S--P--Y--T-----V--K--D--F--V--I--I--P--L--H--T--T--P--E--T--S--V--K--E--I--D--E

---------------------------------------------><-----------------------------------------------------
--L--V--E--V--Y--T--D--V--K--H--R--W--K--A--E--N--F--I--F--M--G--D--F--N--A--G--C--S--Y--V--P--K--K-
GTTGGTTGAGGTCTACACGGACGTGAAACACCGCTGGAAGGCGGAGAATTTCATTTTCATGGGTGACTTCAATGCCGGCTGCAGCTACGTCCCCAAGAAG
:.::::::: :::::. .:::.:::::::.:::::::.:::: ::::::::::::::::::::::::::::::::.:::::::::::.::::::::::::
GCTGGTTGATGTCTATCTGGATGTGAAACGCCGCTGGGAGGCCGAGAATTTCATTTTCATGGGTGACTTCAATGCTGGCTGCAGCTATGTCCCCAAGAAG
--L--V--D--V--Y--L--D--V--K--R--R--W--E--A--E--N--F--I--F--M--G--D--F--N--A--G--C--S--Y--V--P--K--K-

----------------------------------------------------------------------------------------------------
-A--W--K--N--I--R--L--R--T--D--P--R--F--V--W--L--I--G--D--Q--E--D--T--T--V--K--K--S--T--N--C--A--Y--
GCCTGGAAGAACATCCGCTTGAGGACTGACCCCAGGTTTGTTTGGCTGATCGGGGACCAAGAGGACACCACGGTGAAGAAGAGCACCAACTGTGCATATG
::::::::::::::::::.:.::::::::::::: :::..:::::::::::..:::::::::.::::::::.:: ::::::::::: :::::::: ::::
GCCTGGAAGAACATCCGCCTAAGGACTGACCCCATGTTCATTTGGCTGATCAAGGACCAAGAAGACACCACAGTCAAGAAGAGCACAAACTGTGCCTATG
-A--W--K--N--I--R--L--R--T--D--P--M--F--I--W--L--I--K--D--Q--E--D--T--T--V--K--K--S--T--N--C--A--Y--

---><-----------------------------------------------------------------------------------------------
D--R--I--V--L--R--G--Q--E--I--V--S--S--V--V--P--K--S--N--S--V--F--D--F--Q--K--A--Y--K--L--T--E--E--E
ACAGGATTGTGCTTAGAGGACAAGAAATCGTCAGTTCTGTTGTTCCCAAGTCAAACAGTGTTTTTGACTTCCAGAAAGCTTACAAGCTGACTGAAGAGGA
::   ::::::::: :::: :::::.::.:::::.::.::::::::... ::::::::..:.::::::::::::::::::::::.:.:::::::::::.:
AC---ATTGTGCTTCGAGGCCAAGAGATTGTCAGCTCCGTTGTTCCTGGCTCAAACAGCATCTTTGACTTCCAGAAAGCTTACAGGTTGACTGAAGAGAA
D-----I--V--L--R--G--Q--E--I--V--S--S--V--V--P--G--S--N--S--I--F--D--F--Q--K--A--Y--R--L--T--E--E--K

><--------------------------------------------------------------------------------------------------
--A--L--D--V--S--D--H--F--P--V--E--F--K--L--Q--S--S--R--A--F--T--N--S--K--K--S--V--T--L--R--K--K--T-
GGCCCTGGATGTCAGCGACCACTTTCCAGTTGAATTTAAACTACAGTCTTCAAGGGCCTTCACCAACAGCAAAAAATCTGTCACTCTAAGGAAGAAAACA
:::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::..:: ::..::.:::::::: :
GGCCCTGGATGTCAGCGACCACTTTCCAGTTGAATTTAAACTTCAGTCTTCAAGGGCCTTCACCAACAGCAAAAAATCCATCTCTTCAAAGAAGAAAAAA
--A--L--D--V--S--D--H--F--P--V--E--F--K--L--Q--S--S--R--A--F--T--N--S--K--K--S--I--S--S--K--K--K--K-

----------------->
-K--S--K--R--S--*-
AAGAGCAAACGCTCCTAG
:::. ::. ::: ::   
AAGGCCAGTCGCACC---
-K--A--S--R--T----

Pig Consensus Sequence

>BGISUST0000902992
ATGTCTCAGCTGCTGGTCTCCCTGATGCTTCTCCTCCTCTCCACCCACAGTTCCCTGGCCCTGAGGATCTGCTCCTTCAATGTGAGGTCCTTTGGGGAAT
CCAAGAAGGCAAACTGTAATGCCATGGATGTCATCGTGAAGGTCATCAAACGCTGCGACATCATACTCCTGATGGAAATCAAGGACAGCAACAACATGAT
CTGTCCCACGCTGATGGAGAAGCTG------AATTCAAGAAGAAGCGTAACATATAACTATGTGATTAGTTCTCGGCTTGGAAGAAACACATATAAAGAA
CAGTATGCCTTTCTCTAC---GAAAAGCTAGTGTCTGTGAAGAAAAGCTATCTCTACCATGACTATCAGTCTGGAGACGCAGATGTATTTTCCAGGGAAC
CCTTTGTGGTCTGGTTCCAGTCACCCTACACT---GTTAAGGACTTCGTGATCATCCCCCTGCACACCACCCCTGAGACATCCGTTAAAGAGATTGATGA
GCTGGTTGATGTCTATCTGGATGTGAAACGCCGCTGGGAGGCCGAGAATTTCATTTTCATGGGTGACTTCAATGCTGGCTGCAGCTATGTCCCCAAGAAG
GCCTGGAAGAACATCCGCCTAAGGACTGACCCCATGTTCATTTGGCTGATCAAGGACCAAGAAGACACCACAGTCAAGAAGAGCACAAACTGTGCCTATG
AC---ATTGTGCTTCGAGGCCAAGAGATTGTCAGCTCCGTTGTTCCTGGCTCAAACAGCATCTTTGACTTCCAGAAAGCTTACAGGTTGACTGAAGAGAA
GGCCCTGGATGTCAGCGACCACTTTCCAGTTGAATTTAAACTTCAGTCTTCAAGGGCCTTCACCAACAGCAAAAAATCCATCTCTTCAAAGAAGAAAAAA
AAGGCCAGTCGCACC---


>BGISUSP0000902992
MSQLLVSLMLLLLSTHSSLALRICSFNVRSFGESKKANCNAMDVIVKVIKRCDIILLMEIKDSNNMICPTLMEKL--NSRRSVTYNYVISSRLGRNTYKE
QYAFLY-EKLVSVKKSYLYHDYQSGDADVFSREPFVVWFQSPYT-VKDFVIIPLHTTPETSVKEIDELVDVYLDVKRRWEAENFIFMGDFNAGCSYVPKK
AWKNIRLRTDPMFIWLIKDQEDTTVKKSTNCAYD-IVLRGQEIVSSVVPGSNSIFDFQKAYRLTEEKALDVSDHFPVEFKLQSSRAFTNSKKSISSKKKK
KASRT-