Sequences
EST Library Info
cst1Stomach - RNA from China
fhi1Unavailable
mcp1Mammae, collostrum producing
nco1Newborn 115 days, colon
nlu1Newborn 115 days, lung
nmm1Newborn 115 days, mucosal membranes
pigcb1Unavailable
relu2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000151332 (click for geneview)
Transcript ID ENST00000318473(link to ensembl)
Symbol MBIP
Localtion Chromosome:14:35837522:35859596:-1 band: 14q13.3
Description MAP3K12 binding inhibitory protein 1 (MAPK upstream kinase-binding inhibitory protein) (MUK-binding inhibitory protein). [Source:Uniprot/SWISSPROT;Acc:Q9NS73]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--A--T--E--L--N--R--P--S--S--G--D--R--N--L--E--R--R--C--R--P--N--L--S--R--E--V--L--Y--E--I--
ATGGCTGCTGCCACGGAGCTTAATCGCCCGAGCAGCGGTGACAGGAACCTGGAGCGAAGATGCAGACCCAACCTCTCCCGAGAGGTGCTCTACGAAATCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------><----------------------------------------------------------------------
F--R--S--L--H--T--L--V--G--Q--L--D--L--R--D--D--V--V--K--I--T--I--D--W--N--K--L--Q--S--L--S--A--F--Q
TTCGCTCCCTACACACCCTGGTTGGACAGCTTGACCTCAGAGATGATGTGGTGAAAATTACAATCGATTGGAACAAGCTCCAGAGCCTCTCGGCATTCCA
                             :::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
-----------------------------CTTAACCTCAGAGATGATGTGGTGAAAATTACAATCGATTGGAACAAGCTCCAGAGCCTCTCGGCATTCCA
------------------------------L--N--L--R--D--D--V--V--K--I--T--I--D--W--N--K--L--Q--S--L--S--A--F--Q

------------------------------------------------><--------------------------------------------------
--P--A--L--L--F--S--A--L--E--Q--H--I--L--Y--L--Q--P--F--L--A--K--L--Q--S--P--I--K--E--E--N--T--T--A-
GCCTGCATTGCTCTTTAGTGCACTTGAACAACACATTTTATATTTACAGCCTTTTTTAGCAAAACTTCAGTCTCCGATTAAAGAGGAGAATACAACTGCT
:::::: ::::::::::::::::::::.::::::.:::::::::::::::::::::::::::::::::::.:::..::::::::::::::::::.:::.:
GCCTGCTTTGCTCTTTAGTGCACTTGAGCAACACGTTTTATATTTACAGCCTTTTTTAGCAAAACTTCAGCCTCTAATTAAAGAGGAGAATACAGCTGTT
--P--A--L--L--F--S--A--L--E--Q--H--V--L--Y--L--Q--P--F--L--A--K--L--Q--P--L--I--K--E--E--N--T--A--V-

----------------------------------------------------------------------------------------------------
-V--E--E--I--G--R--T--E--M--G--N--K--N--E--V--N--D--K--F--S--I--G--D--L--Q--E--E--E--K--H--K--E--S--
GTTGAAGAGATAGGAAGAACAGAAATGGGGAACAAAAATGAAGTAAATGACAAATTTTCCATTGGCGACCTACAAGAGGAAGAAAAGCACAAAGAAAGTG
::::::::::::::::.::::::::..::::::::.::::::::::::: :::::::.:::::::.::::::::::::::::::::::: :::::  :::
GTTGAAGAGATAGGAAAAACAGAAACAGGGAACAAGAATGAAGTAAATGCCAAATTTCCCATTGGTGACCTACAAGAGGAAGAAAAGCAAAAAGATTGTG
-V--E--E--I--G--K--T--E--T--G--N--K--N--E--V--N--A--K--F--P--I--G--D--L--Q--E--E--E--K--Q--K--D--C--

-------------------------------------------------------------------------><-------------------------
D--L--R--D--V--K--K--T--Q--I--H--F--D--P--E--V--V--Q--I--K--A--G--K--A--E--I--D--R--R--I--S--A--F--I
ATTTAAGAGATGTGAAAAAGACACAGATCCATTTTGATCCAGAAGTAGTTCAGATAAAGGCTGGAAAAGCAGAAATTGACAGACGAATATCTGCATTTAT
:::::.:::::.:::::::::::::::::::::::::::::::::: :::::.:::::.:::::::::::::::::::::::::::::::::::.:::::
ATTTAGGAGATATGAAAAAGACACAGATCCATTTTGATCCAGAAGTCGTTCAAATAAAAGCTGGAAAAGCAGAAATTGACAGACGAATATCTGCGTTTAT
D--L--G--D--M--K--K--T--Q--I--H--F--D--P--E--V--V--Q--I--K--A--G--K--A--E--I--D--R--R--I--S--A--F--I

----------------------------------------------------------------------><----------------------------
--E--R--K--Q--A--E--I--N--E--N--N--V--R--E--F--C--N--V--I--D--C--N--Q--E--N--S--C--A--R--T--D--A--I-
TGAAAGAAAGCAAGCTGAAATCAATGAAAACAACGTCAGGGAATTTTGCAATGTTATTGATTGTAATCAAGAAAATAGTTGTGCAAGAACTGATGCGATT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::                              
TGAAAGAAAGCAAGCTGAAATCAATGAAAACAACGTCAGGGAATTTTGCAATGTTATTGATTGTAATCAA------------------------------
--E--R--K--Q--A--E--I--N--E--N--N--V--R--E--F--C--N--V--I--D--C--N--Q-------------------------------

------------------------------------><--------------------------------------------------------------
-F--T--P--Y--P--G--F--K--S--H--V--K--V--S--R--V--V--N--T--Y--G--P--Q--T--R--P--E--G--I--P--G--S--G--
TTTACCCCTTACCCCGGATTTAAAAGTCACGTAAAAGTTTCTAGAGTTGTGAATACATACGGACCACAGACTAGACCTGAAGGAATTCCAGGGTCAGGTC
                                       ::::::::::::::::::::.:::::::::::::::::::::::::::: :::.:::::::
---------------------------------------TCTAGAGTTGTGAATACATATGGACCACAGACTAGACCTGAAGGAATTCAAGGATCAGGTC
----------------------------------------S--R--V--V--N--T--Y--G--P--Q--T--R--P--E--G--I--Q--G--S--G--

-----------------------------------------------------------------------------------------><---------
H--K--P--N--S--M--L--R--D--C--G--N--Q--A--V--E--E--R--L--Q--N--I--E--A--H--L--R--L--Q--T--G--G--P--V
ATAAACCTAACAGCATGCTTCGAGACTGTGGTAATCAGGCTGTAGAAGAACGACTACAAAATATTGAGGCCCACTTGCGGTTACAGACAGGTGGTCCAGT
:::::::::::::::::::.::.::.:::::::::::::::::.:::::::::::.::::::::::::::.:::::::::::.::::::   ::::::::
ATAAACCTAACAGCATGCTCCGGGATTGTGGTAATCAGGCTGTGGAAGAACGACTGCAAAATATTGAGGCTCACTTGCGGTTGCAGACA---GGTCCAGT
H--K--P--N--S--M--L--R--D--C--G--N--Q--A--V--E--E--R--L--Q--N--I--E--A--H--L--R--L--Q--T-----G--P--V

---------------------------------------------------------------------------------------><-----------
--P--R--D--I--Y--Q--R--I--K--K--L--E--D--K--I--L--E--L--E--G--I--S--P--E--Y--F--Q--S--V--S--F--S--G-
GCCAAGAGACATTTATCAGAGAATTAAAAAACTTGAGGATAAAATCCTTGAATTGGAAGGCATCTCTCCTGAATATTTTCAGTCTGTAAGCTTTTCTGGA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::   :.:::::::::.
GCCAAGAGACATTTATCAGAGAATTAAAAAACTTGAGGATAAAATCCTTGAATTGGAAGGCATCTCTCCTGAATATTTTCAATCT---AACTTTTCTGGG
--P--R--D--I--Y--Q--R--I--K--K--L--E--D--K--I--L--E--L--E--G--I--S--P--E--Y--F--Q--S-----N--F--S--G-

--------------------------><------------------------------------------------------------------------
-K--R--R--K--V--Q--P--P--Q--Q--N--Y--S--L--A--E--L--D--E--K--I--S--A--L--K--Q--A--L--L--R--K--S--R--
AAAAGAAGAAAAGTTCAACCACCTCAACAGAACTATTCACTGGCTGAACTTGATGAGAAAATTAGTGCCCTCAAACAAGCCCTCCTCAGAAAATCAAGAG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:: ::::::::::::::::
AAAAGAAGAAAAGTTCAACCACCTCAACAGAACTATTCACTGGCTGAACTTGATGAGAAAATTAGTGCCCTCAAACAAGCTCTGCTCAGAAAATCAAGAG
-K--R--R--K--V--Q--P--P--Q--Q--N--Y--S--L--A--E--L--D--E--K--I--S--A--L--K--Q--A--L--L--R--K--S--R--

---------------------------------->
E--A--E--S--M--A--T--H--H--L--P--*-
AAGCAGAATCCATGGCAACCCACCACCTTCCATGA
::::::::.::::::::::.::.:::::::: :::
AAGCAGAACCCATGGCAACTCATCACCTTCCCTGA
E--A--E--P--M--A--T--H--H--L--P--*-

Pig Consensus Sequence

>BGISUST0000889969
----------------------------------------------------------------------------------------------------
-----------------------------CTTAACCTCAGAGATGATGTGGTGAAAATTACAATCGATTGGAACAAGCTCCAGAGCCTCTCGGCATTCCA
GCCTGCTTTGCTCTTTAGTGCACTTGAGCAACACGTTTTATATTTACAGCCTTTTTTAGCAAAACTTCAGCCTCTAATTAAAGAGGAGAATACAGCTGTT
GTTGAAGAGATAGGAAAAACAGAAACAGGGAACAAGAATGAAGTAAATGCCAAATTTCCCATTGGTGACCTACAAGAGGAAGAAAAGCAAAAAGATTGTG
ATTTAGGAGATATGAAAAAGACACAGATCCATTTTGATCCAGAAGTCGTTCAAATAAAAGCTGGAAAAGCAGAAATTGACAGACGAATATCTGCGTTTAT
TGAAAGAAAGCAAGCTGAAATCAATGAAAACAACGTCAGGGAATTTTGCAATGTTATTGATTGTAATCAA------------------------------
---------------------------------------TCTAGAGTTGTGAATACATATGGACCACAGACTAGACCTGAAGGAATTCAAGGATCAGGTC
ATAAACCTAACAGCATGCTCCGGGATTGTGGTAATCAGGCTGTGGAAGAACGACTGCAAAATATTGAGGCTCACTTGCGGTTGCAGACA---GGTCCAGT
GCCAAGAGACATTTATCAGAGAATTAAAAAACTTGAGGATAAAATCCTTGAATTGGAAGGCATCTCTCCTGAATATTTTCAATCT---AACTTTTCTGGG
AAAAGAAGAAAAGTTCAACCACCTCAACAGAACTATTCACTGGCTGAACTTGATGAGAAAATTAGTGCCCTCAAACAAGCTCTGCTCAGAAAATCAAGAG
AAGCAGAACCCATGGCAACTCATCACCTTCCCTGA


>BGISUSP0000889969
-------------------------------------------LNLRDDVVKITIDWNKLQSLSAFQPALLFSALEQHVLYLQPFLAKLQPLIKEENTAV
VEEIGKTETGNKNEVNAKFPIGDLQEEEKQKDCDLGDMKKTQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVIDCNQ----------
-------------SRVVNTYGPQTRPEGIQGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQT-GPVPRDIYQRIKKLEDKILELEGISPEYFQS-NFSG
KRRKVQPPQQNYSLAELDEKISALKQALLRKSREAEPMATHHLP*