Sequences
EST Library Info
amn2Amnion
cly5Lymph - RNA from China
csp1Spleen - RNA from China
hyp1Hypothalamus
Clusters
Oligos
SNPs

Gene ID ENSG00000175826 (click for geneview)
Transcript ID ENST00000318988(link to ensembl)
Symbol DULLARD
Localtion Chromosome:17:7087883:7095983:-1 band: 17p13.1
Description dullard homolog [Source:RefSeq_peptide;Acc:NP_056158]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--M--R--T--Q--C--L--L--G--L--R--T--F--V--A--F--A--A--K--L--W--S--F--F--I--Y--L--L--R--R--Q--I--R--
ATGATGCGGACGCAGTGTCTGCTGGGGCTGCGCACGTTCGTGGCCTTCGCCGCCAAGCTCTGGAGCTTCTTCATTTACCTTCTGCGGAGGCAGATCCGCA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::
ATGATGCGGACGCAGTGTCTGCTGGGGCTGCGCACGTTCGTGGCCTTCGCCGCCAAGCTCTGGAGCTTCTTCATTTACCTTTTGCGGAGGCAGATCCGCA
-M--M--R--T--Q--C--L--L--G--L--R--T--F--V--A--F--A--A--K--L--W--S--F--F--I--Y--L--L--R--R--Q--I--R--

-><-----------------------------------------------------------------><------------------------------
T--V--I--Q--Y--Q--T--V--R--Y--D--I--L--P--L--S--P--V--S--R--N--R--L--A--Q--V--K--R--K--I--L--V--L--D
CGGTAATTCAGTACCAAACTGTTCGATATGATATCCTCCCCTTATCTCCTGTGTCCCGGAATCGGCTAGCCCAGGTGAAGAGGAAGATCCTGGTGCTGGA
:::::::::::::::::::.:::::::::::::::::.:::::::::::.::::::::.:::::::::   :::::::::::::::::::::::::::::
CGGTAATTCAGTACCAAACCGTTCGATATGATATCCTTCCCTTATCTCCCGTGTCCCGAAATCGGCTA---CAGGTGAAGAGGAAGATCCTGGTGCTGGA
T--V--I--Q--Y--Q--T--V--R--Y--D--I--L--P--L--S--P--V--S--R--N--R--L-----Q--V--K--R--K--I--L--V--L--D

---------------------------------------------------------------------------------------><-----------
--L--D--E--T--L--I--H--S--H--H--D--G--V--L--R--P--T--V--R--P--G--T--P--P--D--F--I--L--K--V--V--I--D-
TCTGGATGAGACACTTATTCACTCCCACCATGATGGGGTCCTGAGGCCCACAGTCCGGCCTGGTACGCCTCCTGACTTCATCCTCAAGGTGGTAATAGAC
::::::.:::::.::::::::::::::.::::::::::::::::::::::::::::::::::: :::::::::::::::::.:::::::::::.::::::
TCTGGACGAGACGCTTATTCACTCCCATCATGATGGGGTCCTGAGGCCCACAGTCCGGCCTGGAACGCCTCCTGACTTCATTCTCAAGGTGGTGATAGAC
--L--D--E--T--L--I--H--S--H--H--D--G--V--L--R--P--T--V--R--P--G--T--P--P--D--F--I--L--K--V--V--I--D-

-----------------------------------------------------------><---------------------------------------
-K--H--P--V--R--F--F--V--H--K--R--P--H--V--D--F--F--L--E--V--V--S--Q--W--Y--E--L--V--V--F--T--A--S--
AAACATCCTGTCCGGTTTTTTGTACATAAGAGGCCCCATGTGGATTTCTTCCTGGAAGTGGTGAGCCAGTGGTACGAGCTGGTGGTGTTTACAGCAAGCA
::::::::.:::::::::::::::::.::::::::::::::::::::::::.::::::::::::::::::::::::::.:::: :::::.::::::::::
AAACATCCCGTCCGGTTTTTTGTACACAAGAGGCCCCATGTGGATTTCTTCTTGGAAGTGGTGAGCCAGTGGTACGAGTTGGTCGTGTTCACAGCAAGCA
-K--H--P--V--R--F--F--V--H--K--R--P--H--V--D--F--F--L--E--V--V--S--Q--W--Y--E--L--V--V--F--T--A--S--

----------------------------------------------------------------------------><----------------------
M--E--I--Y--G--S--A--V--A--D--K--L--D--N--S--R--S--I--L--K--R--R--Y--Y--R--Q--H--C--T--L--E--L--G--S
TGGAGATCTATGGCTCTGCTGTGGCAGATAAACTGGACAATAGCAGAAGCATTCTTAAGAGGAGATATTACAGACAGCACTGCACTTTGGAGTTGGGCAG
:::::::.::.::::::::.:::::::::::::::::::::::::::::::::::.:::::::::::.:::::::::::.:::::::::::.::::::::
TGGAGATTTACGGCTCTGCCGTGGCAGATAAACTGGACAATAGCAGAAGCATTCTCAAGAGGAGATACTACAGACAGCATTGCACTTTGGAATTGGGCAG
M--E--I--Y--G--S--A--V--A--D--K--L--D--N--S--R--S--I--L--K--R--R--Y--Y--R--Q--H--C--T--L--E--L--G--S

----------------------------------------------------------------------------------------><----------
--Y--I--K--D--L--S--V--V--H--S--D--L--S--S--I--V--I--L--D--N--S--P--G--A--Y--R--S--H--P--D--N--A--I-
CTACATCAAGGACCTCTCTGTGGTCCACAGTGACCTCTCCAGCATTGTGATCCTGGATAACTCCCCAGGGGCTTACAGGAGCCATCCAGACAATGCCATC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::
CTACATCAAGGACCTCTCTGTGGTCCACAGTGACCTCTCCAGCATTGTGATCCTGGATAACTCCCCAGGGGCTTACAGGAGCCATCCA---AATGCCATC
--Y--I--K--D--L--S--V--V--H--S--D--L--S--S--I--V--I--L--D--N--S--P--G--A--Y--R--S--H--P-----N--A--I-

-------------------------------------------------------------------------><-------------------------
-P--I--K--S--W--F--S--D--P--S--D--T--A--L--L--N--L--L--P--M--L--D--A--L--R--F--T--A--D--V--R--S--V--
CCCATCAAATCCTGGTTCAGTGACCCCAGCGACACAGCCCTTCTCAACCTGCTCCCAATGCTGGATGCCCTCAGGTTCACCGCTGATGTTCGTTCCGTGC
::::::::::::::::::::::::::::::::.:: :::::.:::::::::::.:: :::::::::::::::   :::::::: :::::::::::.::::
CCCATCAAATCCTGGTTCAGTGACCCCAGCGATACCGCCCTCCTCAACCTGCTTCCTATGCTGGATGCCCTC---TTCACCGCGGATGTTCGTTCTGTGC
-P--I--K--S--W--F--S--D--P--S--D--T--A--L--L--N--L--L--P--M--L--D--A--L-----F--T--A--D--V--R--S--V--

---------------------------------->
L--S--R--N--L--H--Q--H--R--L--W--*-
TGAGCCGAAACCTTCACCAACATCGGCTCTGGTGA
::::.:::::::::::::::::: :::::::::::
TGAGTCGAAACCTTCACCAACATAGGCTCTGGTGA
L--S--R--N--L--H--Q--H--R--L--W--*-

Pig Consensus Sequence

>BGISUST0000881577
ATGATGCGGACGCAGTGTCTGCTGGGGCTGCGCACGTTCGTGGCCTTCGCCGCCAAGCTCTGGAGCTTCTTCATTTACCTTTTGCGGAGGCAGATCCGCA
CGGTAATTCAGTACCAAACCGTTCGATATGATATCCTTCCCTTATCTCCCGTGTCCCGAAATCGGCTA---CAGGTGAAGAGGAAGATCCTGGTGCTGGA
TCTGGACGAGACGCTTATTCACTCCCATCATGATGGGGTCCTGAGGCCCACAGTCCGGCCTGGAACGCCTCCTGACTTCATTCTCAAGGTGGTGATAGAC
AAACATCCCGTCCGGTTTTTTGTACACAAGAGGCCCCATGTGGATTTCTTCTTGGAAGTGGTGAGCCAGTGGTACGAGTTGGTCGTGTTCACAGCAAGCA
TGGAGATTTACGGCTCTGCCGTGGCAGATAAACTGGACAATAGCAGAAGCATTCTCAAGAGGAGATACTACAGACAGCATTGCACTTTGGAATTGGGCAG
CTACATCAAGGACCTCTCTGTGGTCCACAGTGACCTCTCCAGCATTGTGATCCTGGATAACTCCCCAGGGGCTTACAGGAGCCATCCA---AATGCCATC
CCCATCAAATCCTGGTTCAGTGACCCCAGCGATACCGCCCTCCTCAACCTGCTTCCTATGCTGGATGCCCTC---TTCACCGCGGATGTTCGTTCTGTGC
TGAGTCGAAACCTTCACCAACATAGGCTCTGGTGA


>BGISUSP0000881577
MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRL-QVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVID
KHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHP-NAI
PIKSWFSDPSDTALLNLLPMLDAL-FTADVRSVLSRNLHQHRLW*