Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000113262 (click for geneview)
Transcript ID ENST00000319065(link to ensembl)
Symbol Q8NHA9_HUMAN
Localtion Chromosome:5:178324702:178352038:-1 band: 5q35.3
Description Seven transmembrane helix receptor.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--Q--L--D--G--L--Q--A--L--C--W--G--S--L--F--R--T--Q--L--V--P--V--Y--V--A--V--L--P--S--P--Q--P--C--
ATGCAGCTGGATGGGCTGCAGGCCCTCTGCTGGGGGTCCTTGTTCAGGACACAGCTTGTACCAGTATATGTGGCGGTCCTGCCCTCTCCCCAGCCCTGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
I--P--P--T--C--T--A--F--T--E--F--S--G--P--L--A--K--H--H--S--F--Q--P--F--Q--V--A--A--P--A--G--P--R--S
TACCTCCCACCTGCACAGCATTCACGGAATTCTCAGGCCCACTCGCAAAACACCACAGCTTCCAGCCTTTCCAGGTGGCTGCTCCAGCTGGCCCCAGGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--P--Q--P--F--H--L--P--S--V--S--Q--V--H--A--T--H--L--L--C--P--V--R--V--L--G--P--P--Y--P--P--S--L-
CCCACCCCAACCCTTCCATCTCCCATCTGTGTCCCAGGTCCATGCCACACACCTTCTGTGCCCCGTCCGTGTCCTGGGCCCCCCTTACCCTCCCTCTCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--L--L--T--S--I--H--S--P--A--V--L--P--A--P--Q--I--P--Q--I--S--Y--A--S--T--A--P--E--L--S--D--S--T--
GAGTTACTGACCTCCATCCACAGCCCAGCTGTCCTTCCTGCCCCACAGATACCCCAGATCAGCTATGCCTCCACAGCCCCGGAGCTCAGCGACTCCACAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--Y--D--F--F--S--R--V--V--P--P--D--S--Y--Q--A--Q--A--M--V--D--I--V--R--A--L--G--W--N--Y--V--S--T--L
GCTATGACTTCTTCTCCCGGGTGGTGCCACCCGACTCCTACCAGGCGCAGGCCATGGTGGACATCGTGAGGGCACTGGGATGGAACTATGTGTCCACGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--S--E--G--N--Y--G--E--S--G--V--E--A--F--V--Q--I--S--R--E--A--G--E--L--G--A--P--R--H--Q--G--V--Y-
GGCCTCCGAGGGCAACTATGGCGAAAGTGGGGTTGAGGCCTTCGTTCAGATCTCCCGAGAGGCTGGTGAGCTGGGGGCTCCGAGGCACCAAGGAGTCTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--V--W--A--R--G--P--Q--L--G--Q--K--Q--K--D--G--G--P--R--S--M--L--G--R--G--C--L--A--G--A--P--C--G--
ATAGTGTGGGCCCGGGGCCCTCAGTTGGGGCAGAAGCAGAAAGATGGGGGGCCCAGGTCCATGCTGGGCCGAGGTTGCCTGGCTGGTGCTCCATGTGGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--D--L--F--V--L--D--D--S--A--L--P--Q--A--W--R--R--V--Q--A--R--L--H--P--C--R--P--F--S--Q--P--T--Q--S
GGGACCTCTTTGTTTTGGACGACTCAGCCCTGCCTCAGGCTTGGCGGAGGGTGCAGGCCAGACTTCACCCCTGCAGACCCTTCAGCCAGCCTACACAGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------><-----------------------------------------------------------------------------
--S--A--A--V--A--R--W--S--I--K--I--P--R--E--P--K--P--G--E--F--S--K--V--I--R--R--L--M--E--T--P--N--A-
CTCTGCAGCGGTGGCCAGGTGGTCTATCAAGATTCCCAGGGAACCAAAGCCAGGAGAGTTCAGCAAGGTGATCAGGAGACTCATGGAGACGCCCAACGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------><-------------------------------------------------------------
-R--G--I--I--I--F--A--N--E--D--D--I--S--P--A--P--T--R--R--V--L--E--A--A--R--Q--A--N--L--T--G--H--F--
CGGGGCATCATCATCTTTGCCAATGAGGATGACATCAGCCCTGCTCCTACCAGGCGGGTCCTGGAGGCAGCTCGCCAGGCCAACCTGACCGGCCACTTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--W--V--G--S--D--S--W--G--A--K--T--S--P--I--L--S--L--E--D--V--A--V--G--A--I--T--I--L--P--K--R--A--S
TGTGGGTCGGCTCAGACAGCTGGGGAGCCAAGACCTCACCCATCTTGAGCCTGGAGGACGTGGCCGTTGGGGCCATCACCATCCTGCCCAAAAGGGCCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------><-------------------------------------------------------------------------------------------
--I--D--G--F--D--Q--Y--F--M--T--R--S--L--E--N--N--R--R--N--I--W--F--A--E--F--W--E--E--N--F--N--C--K-
CATCGACGGATTTGACCAGTACTTCATGACTCGATCCCTGGAGAACAACCGCAGGAACATCTGGTTCGCCGAGTTCTGGGAAGAGAATTTTAACTGCAAA
          :::::::::::.::::::::::: ::.::::::::::::::. :::::::::::::.::::::::::::::::::::::::::::::::.
----------TTTGACCAGTATTTCATGACTCGCTCTCTGGAGAACAACCGTCGGAACATCTGGTTTGCCGAGTTCTGGGAAGAGAATTTTAACTGCAAG
-----------F--D--Q--Y--F--M--T--R--S--L--E--N--N--R--R--N--I--W--F--A--E--F--W--E--E--N--F--N--C--K-

-------------------------------------------------------------------><-------------------------------
-L--T--S--S--G--T--Q--S--D--D--S--T--R--K--C--T--G--E--S--C--P--G--W--T--G--E--E--R--I--G--R--D--S--
CTGACCAGCTCAGGTACCCAGTCAGACGATTCCACCCGCAAATGCACAGGTGAGAGCTGCCCAGGGTGGACAGGCGAGGAACGCATCGGCCGGGACTCCA
::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::      :::::.:::::::::::::::::::::::..
CTGATCAGCTCAGGTACCCAGTCAGACGATTCCACCCGCAAATGCACAGGTGAGAGCTGCCCA------ACAGGTGAGGAACGCATCGGCCGGGACTCTG
-L--I--S--S--G--T--Q--S--D--D--S--T--R--K--C--T--G--E--S--C--P--------T--G--E--E--R--I--G--R--D--S--

----------------------------------------------------------------------------------------------------
T--Y--E--Q--E--G--K--V--Q--F--V--I--D--A--V--Y--A--I--A--H--A--L--H--S--M--H--Q--A--L--C--P--G--H--T
CCTACGAGCAGGAGGGCAAGGTGCAGTTTGTGATTGATGCGGTGTACGCCATTGCCCACGCCCTCCACAGCATGCACCAGGCGCTCTGCCCTGGGCACAC
:::::::::::::::: ::::::::.::::::::.::.:: :::::::::::.::::::::::::::::::::::::::::: ::::: ::.::::::::
CCTACGAGCAGGAGGGGAAGGTGCAATTTGTGATCGACGCTGTGTACGCCATCGCCCACGCCCTCCACAGCATGCACCAGGCCCTCTGACCCGGGCACAC
A--Y--E--Q--E--G--K--V--Q--F--V--I--D--A--V--Y--A--I--A--H--A--L--H--S--M--H--Q--A--L--*--P--G--H--T

---------------------------------------------------------><------------><---------------------------
--G--L--C--P--A--M--E--P--T--D--G--R--M--L--L--Q--Y--I--R--C--P--L--Q--W--L--N--R--I--P--L--C--E--W-
AGGCCTGTGCCCGGCGATGGAACCCACTGATGGGCGGATGCTTCTGCAGTACATTCGATGTCCGCTTCAATGGCTGAATCGCATCCCATTGTGTGAATGG
::::::::::::::  :::::.:::                                                                           
AGGCCTGTGCCCGGGCATGGAGCCC---------------------------------------------------------------------------
--G--L--C--P--G--M--E--P----------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--R--R--V--R--P--F--F--C--Q--W--T--L--G--L--L--S--S--C--G--Y--V--N--N--A--A--V--N--V--A--V--Q--A--
CCCCGTCGTGTTCGTCCATTCTTCTGTCAGTGGACGCTCGGGTTGCTTTCATCTTGTGGCTATGTGAATAACGCTGCTGTGAACGTGGCTGTACAAGCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--L--A--T--L--L--S--S--L--S--S--I--Y--P--G--V--E--L--L--G--H--V--F--N--L--L--R--R--L--H--T--V--F--C
TTCTTGCCACCCTGCTTTCTAGTCTCTCGAGTATCTACCCGGGAGTGGAACTGCTGGGTCATGTGTTTAATCTTTTGAGGAGGCTCCACACTGTTTTCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------><-------------------------------------------------------------
--S--G--C--S--L--F--P--P--T--V--H--K--G--S--A--G--T--P--V--M--F--N--E--N--G--D--A--P--G--R--Y--D--I-
CAGCGGCTGCAGCCTTTTCCCACCCACCGTGCACAAGGGCAGCGCAGGAACCCCTGTGATGTTCAACGAGAACGGAGATGCGCCCGGGCGGTACGACATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-F--Q--Y--Q--A--T--N--G--S--A--S--S--G--G--Y--Q--A--V--G--Q--W--A--E--T--L--R--L--D--V--S--V--Q--T--
TTCCAGTACCAGGCGACCAATGGCAGTGCCAGCAGTGGCGGGTACCAGGCAGTGGGCCAGTGGGCAGAGACCCTCAGACTGGATGTGAGTGTGCAGACCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--P--Q--V--G--M--G--P--G--S--R--R--Q--T--P--Q--P--V--F--C--A--S--Q--V--E--A--L--Q--W--S--G--D--P--H
AGCCCCAGGTGGGCATGGGCCCAGGATCCCGGAGGCAGACGCCCCAGCCTGTGTTTTGTGCGTCCCAGGTGGAGGCCCTGCAGTGGTCTGGCGACCCCCA
                                                                 ::::::::.:::::::::::::: :: .: :::::
-----------------------------------------------------------------CAGGTGGAAGCCCTGCAGTGGTCGGGAAA-CCCCA
------------------------------------------------------------------Q--V--E--A--L--Q--W--S--G--N--P--H

----------------------------------------------------------------------------------------------------
--E--V--P--S--S--L--C--S--L--P--C--G--P--G--E--R--K--K--M--V--K--G--V--P--C--C--W--H--C--E--A--C--D-
CGAGGTGCCCTCGTCTCTGTGCAGCCTGCCCTGCGGGCCGGGGGAGCGGAAGAAGATGGTGAAGGGCGTCCCCTGCTGTTGGCACTGCGAGGCCTGTGAC
:::::: ::: :::::: :::::::::::::::.:::::.:: ::::::::.::::::::::::::.:: ::::::::::::::::::::::::::.:::
CGAGGTCCCCGCGTCTCAGTGCAGCCTGCCCTGTGGGCCAGG-GAGCGGAAAAAGATGGTGAAGGGTGT-CCCTGCTGTTGGCACTGCGAGGCCTGCGAC
--E--V--P--A--S--Q--C--S--L--P--C--G--P--G--E--R--K--K--M--V--K--G--V--P--C--C--W--H--C--E--A--C--D-

----------------------------------------------------------------------------------------------------
-G--Y--R--F--Q--V--D--E--F--T--C--E--A--C--P--G--D--M--R--P--T--P--N--H--T--G--C--R--P--T--P--V--V--
GGGTACCGCTTCCAGGTGGACGAGTTCACATGCGAGGCCTGTCCTGGGGACATGAGGCCCACGCCCAACCACACGGGCTGCCGCCCCACACCTGTGGTGC
:: ::::::::::::::::::::::::::.:::::::::::.::.::: ::::::::::::::: :::::::::::::::::::::::::::.::::: :
GGCTACCGCTTCCAGGTGGACGAGTTCACGTGCGAGGCCTGCCCCGGGCACATGAGGCCCACGCGCAACCACACGGGCTGCCGCCCCACACCCGTGGTCC
-G--Y--R--F--Q--V--D--E--F--T--C--E--A--C--P--G--H--M--R--P--T--R--N--H--T--G--C--R--P--T--P--V--V--

----------------------------------------------------------------------------------------------------
R--L--S--W--S--S--P--W--A--A--P--P--L--L--L--A--V--L--G--I--V--A--T--T--T--V--V--A--T--F--V--R--Y--N
GCCTGAGCTGGTCCTCCCCCTGGGCAGCCCCGCCGCTCCTCCTGGCCGTGCTGGGCATCGTGGCCACTACCACGGTGGTGGCCACCTTCGTGCGGTACAA
:::::  ::::::::: ::::::::::::::::: ::::::::::::::::::::::::.:::::::.::::::::::::::::::::.::::::.::::
GCCTGTCCTGGTCCTCGCCCTGGGCAGCCCCGCCCCTCCTCCTGGCCGTGCTGGGCATCATGGCCACCACCACGGTGGTGGCCACCTTTGTGCGGCACAA
R--L--S--W--S--S--P--W--A--A--P--P--L--L--L--A--V--L--G--I--M--A--T--T--T--V--V--A--T--F--V--R--H--N

----------------------------------------------------------------------------------------------------
--N--T--P--I--V--R--A--S--G--R--E--L--S--Y--V--L--L--T--G--I--F--L--I--Y--A--I--T--F--L--M--V--A--E-
CAACACGCCCATCGTCCGGGCCTCGGGCCGAGAGCTCAGCTACGTCCTCCTCACCGGCATCTTCCTCATCTACGCCATCACCTTCCTCATGGTGGCTGAG
:::::::::::::::::::::.:: ::::: ::::::::::::::::::::::: ::::::::::::::.::::::::::::::::::::::::::.:::
CAACACGCCCATCGTCCGGGCTTCCGGCCGCGAGCTCAGCTACGTCCTCCTCACGGGCATCTTCCTCATTTACGCCATCACCTTCCTCATGGTGGCCGAG
--N--T--P--I--V--R--A--S--G--R--E--L--S--Y--V--L--L--T--G--I--F--L--I--Y--A--I--T--F--L--M--V--A--E-

----------------------------------------------------------------------------------------------------
-P--G--A--A--V--C--A--A--R--R--L--F--L--G--L--G--T--T--L--S--Y--S--A--L--L--T--K--T--N--R--I--Y--R--
CCTGGGGCCGCGGTCTGTGCCGCCCGCAGGCTCTTCCTGGGCCTGGGCACGACCCTCAGCTACTCTGCCCTGCTCACCAAGACCAACCGTATCTACCGCA
::.::::: :: :::::.:: ::.:::::::::::::: :::::: :::: ::::::::::::::::::.:::::::::::::::::::.::::::::::
CCCGGGGCGGCTGTCTGCGCGGCTCGCAGGCTCTTCCTTGGCCTGTGCACCACCCTCAGCTACTCTGCCTTGCTCACCAAGACCAACCGCATCTACCGCA
-P--G--A--A--V--C--A--A--R--R--L--F--L--G--L--C--T--T--L--S--Y--S--A--L--L--T--K--T--N--R--I--Y--R--

----------------------------------------------------------------------------------------------------
I--F--E--Q--G--K--R--S--V--T--P--P--P--F--I--S--P--T--S--Q--L--V--I--T--F--S--L--T--S--L--Q--I--N--A
TCTTTGAGCAGGGCAAGCGCTCGGTCACACCCCCTCCCTTCATCAGCCCCACCTCACAGCTGGTCATCACCTTCAGCCTCACCTCCCTGCAGATAAATGC
::::.:::::.:: ::::::::::: :::::::: :::::::::::::::                                                  
TCTTCGAGCAAGGGAAGCGCTCGGTGACACCCCCGCCCTTCATCAGCCCC--------------------------------------------------
I--F--E--Q--G--K--R--S--V--T--P--P--P--F--I--S--P---------------------------------------------------

><-----------------------------------------><-----------------------------------------><------------
--V--F--R--V--T--L--F--Y--F--G--S--L--Q--W--H--Y--L--S--S--L--Q--A--L--P--S--G--V--G--L--Q--R--S--F-
CGTTTTTAGAGTCACTCTTTTCTATTTTGGTTCCTTGCAGTGGCACTATCTCAGCTCCCTGCAAGCTCTGCCTTCCGGTGTGGGCCTCCAGAGATCTTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-C--T--T--V--K--L--F--S--K--P--K--C--S--S--T--I--W--L--T--Y--G--N--R--S--K--S--Y--L--T--G--F--P--Q--
TGTACAACAGTGAAGTTATTTTCTAAACCAAAATGCTCTTCTACAATTTGGCTCACATATGGAAACAGGTCAAAGAGCTATCTGACCGGTTTTCCTCAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----><--------------><------------------------------------------------------------------------------
R--G--H--I--S--E--G--R--G--D--W--P--H--V--K--V--M--V--V--V--Y--Q--S--S--L--V--Y--Y--M--K--Q--A--Q--A
GAGGGCACATTAGTGAGGGGCGGGGAGACTGGCCTCATGTGAAGGTCATGGTCGTGGTGTACCAGAGCAGTCTTGTGTACTACATGAAGCAGGCGCAGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--R--V--K--T--E--L--L--K--V--A--H--H--Q--V--A--K--S--V--P--E--E--S--Q--I--V--V--L--H--L--V--T--A-
TGGACGTGTGAAGACAGAGCTGCTGAAGGTGGCACATCACCAGGTGGCCAAGTCTGTCCCTGAAGAGTCCCAAATCGTGGTCCTTCATCTTGTCACAGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------><----------------------------------------------------
-G--Y--V--D--M--A--I--R--T--T--R--A--S--L--H--L--M--P--L--T--L--V--P--G--A--A--A--E--V--N--E--T--Q--
GGGTATGTCGACATGGCCATTAGGACTACAAGAGCAAGCCTGCACTTAATGCCGCTGACGCTAGTTCCTGGAGCCGCGGCTGAGGTGAATGAGACTCAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--A--A--R--L--G--P--G--S--T--V--G--T--Y--Q--V--V--V--V--L--M--R--S--L--Q--I--D--K--T--T--N--Q--L--S
TGGCTGCACGCCTTGGTCCTGGCTCAACGGTAGGCACATACCAAGTAGTGGTAGTTCTCATGCGTTCATTACAGATAGACAAAACCACCAACCAACTCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------><----------------------------
--L--E--T--C--F--S--G--I--Q--G--F--L--A--S--V--N--S--L--V--M--D--K-
CTTAGAAACGTGCTTCTCAGGGATTCAAGGGTTTCTCGCCAGTGTGAATTCTTTGGTGATGGATAAG
                                                                   
-------------------------------------------------------------------
-------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000891242
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------TTTGACCAGTATTTCATGACTCGCTCTCTGGAGAACAACCGTCGGAACATCTGGTTTGCCGAGTTCTGGGAAGAGAATTTTAACTGCAAG
CTGATCAGCTCAGGTACCCAGTCAGACGATTCCACCCGCAAATGCACAGGTGAGAGCTGCCCA------ACAGGTGAGGAACGCATCGGCCGGGACTCTG
CCTACGAGCAGGAGGGGAAGGTGCAATTTGTGATCGACGCTGTGTACGCCATCGCCCACGCCCTCCACAGCATGCACCAGGCCCTCTGACCCGGGCACAC
AGGCCTGTGCCCGGGCATGGAGCCC---------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------CAGGTGGAAGCCCTGCAGTGGTCGGGacCCCACGA
GGTCCCCGCGTCTCAGTGCAGCCTGCCCTGTGGGCCagAGCGGAAAAAGATGGTGAAGGGtcCCTGCTGTTGGCACTGCGAGGCCTGCGACGGCTACCGC
TTCCAGGTGGACGAGTTCACGTGCGAGGCCTGCCCCGGGCACATGAGGCCCACGCGCAACCACACGGGCTGCCGCCCCACACCCGTGGTCCGCCTGTCCT
GGTCCTCGCCCTGGGCAGCCCCGCCCCTCCTCCTGGCCGTGCTGGGCATCATGGCCACCACCACGGTGGTGGCCACCTTTGTGCGGCACAACAACACGCC
CATCGTCCGGGCTTCCGGCCGCGAGCTCAGCTACGTCCTCCTCACGGGCATCTTCCTCATTTACGCCATCACCTTCCTCATGGTGGCCGAGCCCGGGGCG
GCTGTCTGCGCGGCTCGCAGGCTCTTCCTTGGCCTGTGCACCACCCTCAGCTACTCTGCCTTGCTCACCAAGACCAACCGCATCTACCGCATCTTCGAGC
AAGGGAAGCGCTCGGTGACACCCCCGCCCTTCATCAGCCCC-----------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------


>BGISUSP0000891242
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------FDQYFMTRSLENNRRNIWFAEFWEENFNCK
LISSGTQSDDSTRKCTGESCP--TGEERIGRDSAYEQEGKVQFVIDAVYAIAHALHSMHQAL*PGHTGLCPGMEP-------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------QVEALQWSGPHEVPASQCSLPCGPERKKMVKGPCCWHCEACDGYR
FQVDEFTCEACPGHMRPTRNHTGCRPTPVVRLSWSSPWAAPPLLLAVLGIMATTTVVATFVRHNNTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPGA
AVCAARRLFLGLCTTLSYSALLTKTNRIYRIFEQGKRSVTPPPFISP-----------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------