Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
eje1Foetus 50 days, jejunum
Clusters
Oligos
SNPs

Gene ID ENSG00000179965 (click for geneview)
Transcript ID ENST00000319296(link to ensembl)
Symbol NP_057727.1
Localtion Chromosome:16:30326437:30337416:1 band: 16p11.2
Description mesenchymal stem cell protein DSC43
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--G--E--Q--Q--A--E--E--E--E--E--E--E--M--Q--E--E--M--V--L--L--V--K--G--E--E--D--E--G--E--E--K--
ATGCCTGGCGAACAGCAGGCAGAGGAAGAGGAGGAGGAAGAGATGCAGGAGGAGATGGTGCTGCTGGTGAAGGGTGAGGAGGATGAGGGTGAGGAGAAGT
:::::.::::::::::::.:::::::.::::::::::::::.:::::.::::::::::::::::::::::::::::::::::::::::::::.:::::::
ATGCCCGGCGAACAGCAGACAGAGGAGGAGGAGGAGGAAGAAATGCAAGAGGAGATGGTGCTGCTGGTGAAGGGTGAGGAGGATGAGGGTGAAGAGAAGT
-M--P--G--E--Q--Q--T--E--E--E--E--E--E--E--M--Q--E--E--M--V--L--L--V--K--G--E--E--D--E--G--E--E--K--

----------------------------------------><----------------------------------------------------------
Y--E--V--V--K--L--K--I--P--M--D--N--K--E--V--P--G--E--A--P--A--P--S--A--D--P--A--R--P--H--A--C--P--D
ATGAGGTGGTGAAACTCAAGATCCCCATGGACAACAAGGAGGTCCCGGGCGAGGCGCCCGCGCCGTCCGCCGACCCGGCGCGTCCCCACGCGTGCCCCGA
::::.::::::::::::::::::::: ::::::::::::::::::::.::::: :::: ::.:::::.::::::::::::::.:: ::::::::::: ::
ATGAAGTGGTGAAACTCAAGATCCCCCTGGACAACAAGGAGGTCCCGAGCGAGCCGCCAGCACCGTCTGCCGACCCGGCGCGCCCACACGCGTGCCCGGA
Y--E--V--V--K--L--K--I--P--L--D--N--K--E--V--P--S--E--P--P--A--P--S--A--D--P--A--R--P--H--A--C--P--D

----------------------------------------------------------------------------------------------------
--C--G--R--A--F--A--R--R--S--T--L--A--K--H--A--R--T--H--T--G--E--R--P--F--G--C--T--E--C--G--R--R--F-
CTGCGGCCGCGCCTTCGCGCGCCGCTCCACGCTGGCGAAGCACGCGCGCACGCACACGGGCGAACGGCCCTTCGGGTGCACCGAGTGCGGGCGGCGCTTC
::::::::: :::::.:::::::::::::::::::: :::::::: :::::::::::::::::.:::::::::: ::::::::::::::: :::::::::
CTGCGGCCGGGCCTTTGCGCGCCGCTCCACGCTGGCCAAGCACGCCCGCACGCACACGGGCGAGCGGCCCTTCGCGTGCACCGAGTGCGGCCGGCGCTTC
--C--G--R--A--F--A--R--R--S--T--L--A--K--H--A--R--T--H--T--G--E--R--P--F--A--C--T--E--C--G--R--R--F-

----------------------------------------------------------------------------------------------------
-S--Q--K--S--A--L--T--K--H--G--R--T--H--T--G--E--R--P--Y--E--C--P--E--C--D--K--R--F--S--A--A--S--N--
TCACAGAAGTCGGCGCTGACCAAACACGGCCGCACGCACACGGGCGAGCGGCCCTACGAGTGCCCCGAGTGCGACAAACGCTTCTCGGCCGCCTCGAACC
::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::.:::::::: :::::::::::::
TCGCAGAAGTCGGCGCTGACCAAACACGGCCGCACGCACACGGGCGAGCGGCCCTACGAGTGCCCGGAGTGCGACAAGCGCTTCTCCGCCGCCTCGAACC
-S--Q--K--S--A--L--T--K--H--G--R--T--H--T--G--E--R--P--Y--E--C--P--E--C--D--K--R--F--S--A--A--S--N--

----------------------------------------------------------------------------------------------------
L--R--Q--H--R--R--R--H--T--G--E--K--P--Y--A--C--A--H--C--G--R--R--F--A--Q--S--S--N--Y--A--Q--H--L--R
TGCGGCAGCACCGGCGGCGGCACACGGGCGAGAAGCCGTACGCATGCGCGCACTGCGGCCGCCGCTTCGCGCAGAGCTCCAACTACGCACAGCACCTGCG
::::::::::::::::::: ::::::::::::::::::::::::::::: ::::::::.::::::::::::::::::::::::::::: :::::::::::
TGCGGCAGCACCGGCGGCGCCACACGGGCGAGAAGCCGTACGCATGCGCTCACTGCGGTCGCCGCTTCGCGCAGAGCTCCAACTACGCCCAGCACCTGCG
L--R--Q--H--R--R--R--H--T--G--E--K--P--Y--A--C--A--H--C--G--R--R--F--A--Q--S--S--N--Y--A--Q--H--L--R

----------------------------------------------------------------------------------------------------
--V--H--T--G--E--K--P--Y--A--C--P--D--C--G--R--A--F--G--G--S--S--C--L--A--R--H--R--R--T--H--T--G--E-
CGTGCACACGGGCGAGAAGCCGTACGCGTGCCCGGACTGCGGACGCGCCTTTGGCGGCAGCTCGTGCCTGGCGCGCCACCGACGCACGCACACGGGCGAG
:::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.:::::::::::::::::::::::::::::::::::::::
CGTGCACACGGGCGAGAAGCCGTACGCGTGCCCGGACTGCGGACGCGCCTTCGGCGGCAGTTCGTGCCTGGCGCGCCACCGACGCACGCACACGGGCGAG
--V--H--T--G--E--K--P--Y--A--C--P--D--C--G--R--A--F--G--G--S--S--C--L--A--R--H--R--R--T--H--T--G--E-

----------------------------------------------------------------------------------------------------
-R--P--Y--A--C--A--D--C--G--T--R--F--A--Q--S--S--A--L--A--K--H--R--R--V--H--T--G--E--K--P--H--R--C--
CGGCCCTACGCTTGCGCCGACTGCGGCACGCGCTTCGCTCAGAGCTCGGCGCTGGCCAAGCACCGGCGCGTGCACACGGGCGAGAAGCCGCACCGCTGCG
::::: ::::: :::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CGGCCGTACGCATGCGCCGACTGCGGCACGCGCTTCGCGCAGAGCTCGGCGCTGGCCAAGCACCGGCGCGTGCACACGGGCGAGAAGCCGCACCGCTGCG
-R--P--Y--A--C--A--D--C--G--T--R--F--A--Q--S--S--A--L--A--K--H--R--R--V--H--T--G--E--K--P--H--R--C--

----------------------------------------------------------------------------------------------------
A--V--C--G--R--R--F--G--H--R--S--N--L--A--E--H--A--R--T--H--T--G--E--R--P--Y--P--C--A--E--C--G--R--R
CTGTGTGTGGCCGTCGCTTCGGCCACCGCTCCAACCTGGCGGAGCACGCGCGCACGCACACAGGCGAGCGGCCCTACCCCTGCGCCGAGTGCGGCCGCCG
:.:::::.:::::.::.::::::::::::::.::::::::::::::.::::::::::::::.:: ::::::::.::::: ::: ::::::::::::: ::
CCGTGTGCGGCCGCCGTTTCGGCCACCGCTCTAACCTGGCGGAGCATGCGCGCACGCACACGGGGGAGCGGCCTTACCCGTGCTCCGAGTGCGGCCGGCG
A--V--C--G--R--R--F--G--H--R--S--N--L--A--E--H--A--R--T--H--T--G--E--R--P--Y--P--C--S--E--C--G--R--R

----------------------------------------------------------------------------------------------------
--F--R--L--S--S--H--F--I--R--H--R--R--A--H--M--R--R--R--L--Y--I--C--A--G--C--G--R--D--F--K--L--P--P-
CTTCCGCCTAAGCTCGCACTTCATTCGCCACCGACGCGCGCACATGCGGCGCCGCCTGTATATTTGCGCCGGCTGCGGCAGGGACTTCAAGCTGCCCCCT
::::::::: ::::::::::::::.:::::::::::::::::::::::::: ::.:: :::::.::.::.::::::::: ::::::::::::: ::.:: 
CTTCCGCCTCAGCTCGCACTTCATCCGCCACCGACGCGCGCACATGCGGCGGCGTCTTTATATCTGTGCTGGCTGCGGCCGGGACTTCAAGCTCCCTCCG
--F--R--L--S--S--H--F--I--R--H--R--R--A--H--M--R--R--R--L--Y--I--C--A--G--C--G--R--D--F--K--L--P--P-

----------------------------------------------------->
-G--A--T--A--A--T--A--T--E--R--C--P--E--C--E--G--S--*-
GGCGCCACGGCCGCCACTGCCACCGAGCGTTGCCCGGAGTGTGAGGGCAGCTGA
::::::::.::::::::::::::::::::.:::::.:: ::::.::::::::::
GGCGCCACAGCCGCCACTGCCACCGAGCGCTGCCCAGATTGTGGGGGCAGCTGA
-G--A--T--A--A--T--A--T--E--R--C--P--D--C--G--G--S--*-

Pig Consensus Sequence

>BGISUST0000891105
ATGCCCGGCGAACAGCAGACAGAGGAGGAGGAGGAGGAAGAAATGCAAGAGGAGATGGTGCTGCTGGTGAAGGGTGAGGAGGATGAGGGTGAAGAGAAGT
ATGAAGTGGTGAAACTCAAGATCCCCCTGGACAACAAGGAGGTCCCGAGCGAGCCGCCAGCACCGTCTGCCGACCCGGCGCGCCCACACGCGTGCCCGGA
CTGCGGCCGGGCCTTTGCGCGCCGCTCCACGCTGGCCAAGCACGCCCGCACGCACACGGGCGAGCGGCCCTTCGCGTGCACCGAGTGCGGCCGGCGCTTC
TCGCAGAAGTCGGCGCTGACCAAACACGGCCGCACGCACACGGGCGAGCGGCCCTACGAGTGCCCGGAGTGCGACAAGCGCTTCTCCGCCGCCTCGAACC
TGCGGCAGCACCGGCGGCGCCACACGGGCGAGAAGCCGTACGCATGCGCTCACTGCGGTCGCCGCTTCGCGCAGAGCTCCAACTACGCCCAGCACCTGCG
CGTGCACACGGGCGAGAAGCCGTACGCGTGCCCGGACTGCGGACGCGCCTTCGGCGGCAGTTCGTGCCTGGCGCGCCACCGACGCACGCACACGGGCGAG
CGGCCGTACGCATGCGCCGACTGCGGCACGCGCTTCGCGCAGAGCTCGGCGCTGGCCAAGCACCGGCGCGTGCACACGGGCGAGAAGCCGCACCGCTGCG
CCGTGTGCGGCCGCCGTTTCGGCCACCGCTCTAACCTGGCGGAGCATGCGCGCACGCACACGGGGGAGCGGCCTTACCCGTGCTCCGAGTGCGGCCGGCG
CTTCCGCCTCAGCTCGCACTTCATCCGCCACCGACGCGCGCACATGCGGCGGCGTCTTTATATCTGTGCTGGCTGCGGCCGGGACTTCAAGCTCCCTCCG
GGCGCCACAGCCGCCACTGCCACCGAGCGCTGCCCAGATTGTGGGGGCAGCTGA


>BGISUSP0000891105
MPGEQQTEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPLDNKEVPSEPPAPSADPARPHACPDCGRAFARRSTLAKHARTHTGERPFACTECGRRF
SQKSALTKHGRTHTGERPYECPECDKRFSAASNLRQHRRRHTGEKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYACPDCGRAFGGSSCLARHRRTHTGE
RPYACADCGTRFAQSSALAKHRRVHTGEKPHRCAVCGRRFGHRSNLAEHARTHTGERPYPCSECGRRFRLSSHFIRHRRAHMRRRLYICAGCGRDFKLPP
GATAATATERCPDCGGS*