Sequences
EST Library Info
cov2Ovary - RNA from China
nca1Newborn 115 days, cartillage
pigcb1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000184716 (click for geneview)
Transcript ID ENST00000319327(link to ensembl)
Localtion Chromosome:15:41873664:41879006:-1 band: 15q15.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-L--A--A--L--H--L--L--Y--S--Q--V--C--C--C--G--P--A--P--C--A--S--C--C--H--S--R--W--P--S--L--T--A--S--
CTCGCTGCCTTGCATCTGCTCTACTCCCAGGTGTGCTGCTGTGGGCCTGCTCCTTGTGCCAGCTGCTGCCACTCTAGGTGGCCCTCTCTCACCGCATCCA
   ::::::.::::. ::::::::.:.::::::: ::::::::::::::.:.:.:::.:: :::::.: ::.:::::::::::..::::::: : .::. 
---GCTGCCCTGCACGTGCTCTACCCTCAGGTGTCCTGCTGTGGGCCTGTTTCCTGTACCTGCTGCCGGCATTCTAGGTGGCCTCCTCTCACAGAGTCTC
----A--A--L--H--V--L--Y--P--Q--V--S--C--C--G--P--V--S--C--T--C--C--R--H--S--R--W--P--P--L--T--E--S--

----------------------------------------------------------------------------------------------------
T--C--S--R-----L--F--Y--I--L--L--H--V--G--A--S--A--I--C--C--L--L--L--S--R--T--V--V--E--R--V--W--G--K
CTTGCAGCCGC---CTGTTCTACATCCTCCTCCATGTGGGGGCCTCAGCAATCTGCTGCCTCCTGCTGTCAAGGACAGTAGTGGAAAGGGTGTGGGGCAA
::::.:  ::    :::::::::::.::::::::::::::::::::::::.:::::::::::::..::::::::                          
CTTGTACGCGGC--CTGTTCTACATTCTCCTCCATGTGGGGGCCTCAGCAGTCTGCTGCCTCCTATTGTCAAGG--------------------------
P--C--T--R--\--L--F--Y--I--L--L--H--V--G--A--S--A--V--C--C--L--L--L--S--R---------------------------

---------><-----------------------------------------------------------------------------------------
--T--H--R--I--Q--M--P--S--G--L--C--A--H--L--F--G--L--S--D--C--P--V--L--S--G--S--G--A--V--Y--R--V--C-
GACACACAGGATCCAGATGCCCTCGGGGTTGTGTGCCCACCTGTTTGGCCTCTCTGACTGTCCAGTGCTCAGTGGCTCTGGGGCTGTGTACCGAGTATGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------><----------
-A--G--T--A--T--F--H--L--L--Q--A--V--L--L--V--H--L--H--S--P--T--S--P--R--A--Q--L--H--N--S--F--W--L--
GCAGGAACCGCCACCTTCCACCTGCTGCAGGCTGTGTTGCTGGTCCACCTCCACTCCCCCACCAGCCCGCGGGCACAGCTGCATAATAGCTTCTGGCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------><------------------------------
L--K--L--L--F--L--L--G--L--C--A--I--A--F--C--I--P--D--E--H--L--F--P--A--W--H--Y--I--G--I--C--G--G--F
TCAAGCTGCTGTTCCTGTTAGGTCTCTGTGCTATTGCCTTCTGCATTCCTGATGAGCATCTCTTCCCAGCATGGCATTACATTGGCATCTGTGGAGGCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------><------------------------------------
--A--F--I--L--L--Q--L--V--L--I--T--A--F--A--H--S--W--N--K--N--W--Q--T--G--A--A--Q--D--C--S--W--F--L-
TGCATTCATCCTACTGCAGTTGGTGCTTATTACAGCTTTTGCCCATTCCTGGAACAAGAACTGGCAGACAGGTGCAGCTCAAGACTGTAGCTGGTTCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--V--L--L--A--T--L--G--F--Y--S--M--A--G--V--G--A--V--L--L--F--H--Y--Y--T--H--P--A--G--C--L--L--N--
GCTGTCCTGCTGGCCACCCTAGGATTCTACAGCATGGCAGGTGTGGGAGCTGTGCTCCTATTCCACTATTATACACACCCAGCTGGCTGCCTGCTTAACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------><------------------------
K--M--L--L--S--L--H--L--C--F--C--G--L--I--S--F--L--S--I--A--P--C--I--R--L--K--Q--P--R--S--G--L--L--Q
AGATGCTCCTCAGTCTGCACCTTTGCTTCTGTGGCCTCATCTCCTTCCTCTCCATCGCTCCTTGCATCCGCCTCAAGCAACCCCGCTCTGGCCTCCTACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------><----------------------------
--A--S--V--I--S--C--Y--I--M--Y--L--T--F--S--A--L--S--S--R--P--P--E--R--E--P--S--R--A--L--T--K--V--V-
AGCTTCTGTCATCAGCTGCTATATCATGTATCTGACTTTCTCTGCACTGTCCAGCCGTCCTCCAGAGAGAGAACCCTCAAGAGCCTTAACAAAGGTAGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--G--E--G--K--R--C--F--S--S--S--A--P--S--S--H--F--L--S--P--G--Q--R--G--G--A--A--R--P--A--D--Q--E--
GGGGGAGAGGGGAAGAGGTGTTTCAGCAGCTCTGCTCCCAGCAGCCATTTCCTCTCTCCAGGGCAAAGGGGTGGGGCTGCGAGGCCAGCTGACCAAGAAA
   ::.: ::::.::::::::::::::::::::::: :::::::.: :::::: ::::::::::::::.::::::.:::: ::::::::::::::::: :
---GGGGTGGGGGAGAGGTGTTTCAGCAGCTCTGCTGCCAGCAGTCCTTTCCTATCTCCAGGGCAAAGAGGTGGGACTGCCAGGCCAGCTGACCAAGATA
----G--V--G--E--R--C--F--S--S--S--A--A--S--S--P--F--L--S--P--G--Q--R--G--G--T--A--R--P--A--D--Q--D--

----------------------------------------------------------------------------------------------------
T--P--P--A--P--P--V--Q--V--Q--H--L--S--Y--N--Y--S--A--F--H--F--V--F--F--L--A--S--L--Y--V--M--V--T--L
CCCCTCCAGCTCCTCCAGTCCAAGTCCAGCATCTTTCCTACAACTATTCTGCCTTCCACTTCGTCTTCTTCCTTGCCTCACTCTATGTCATGGTTACCCT
::.:::::::::.:::::. ::::.:::::: ::::::::::.::::::::::::::::::.::::::::::: :: :::::::::::::::::::::::
CCTCTCCAGCTCTTCCAGCGCAAGCCCAGCAGCTTTCCTACAGCTATTCTGCCTTCCACTTTGTCTTCTTCCTAGCATCACTCTATGTCATGGTTACCCT
T--S--P--A--L--P--A--Q--A--Q--Q--L--S--Y--S--Y--S--A--F--H--F--V--F--F--L--A--S--L--Y--V--M--V--T--L

--------------><------------------------------------------------------------------------------------
--T--N--W--F--S--Y--E--G--A--E--L--E--K--T--F--I--K--G--S--W--A--T--F--W--V--K--V--A--S--C--W--A--C-
TACCAACTGGTTCAGCTATGAGGGAGCAGAACTGGAAAAGACCTTCATCAAGGGTAGCTGGGCCACCTTCTGGGTCAAGGTTGCCTCATGCTGGGCCTGC
.::::::::::::   :::::::::::::::::::::::::: ::::.:: ::::::::::::.::.::::::::::::::::::::::::::::::::.
CACCAACTGGTTC---TATGAGGGAGCAGAACTGGAAAAGACGTTCACCATGGGTAGCTGGGCTACTTTCTGGGTCAAGGTTGCCTCATGCTGGGCCTGT
--T--N--W--F-----Y--E--G--A--E--L--E--K--T--F--T--M--G--S--W--A--T--F--W--V--K--V--A--S--C--W--A--C-

----------------------------------------------------------------------------------------------------
-V--L--L--Y--L--G--L--L--L--A--P--L--C--W--P--P--T--Q--K--P--Q--P--L-----I--L--R--R--R--R--H--R--I--
GTACTCCTCTATCTGGGGCTGTTACTGGCACCACTCTGTTGGCCCCCCACCCAGAAACCCCAGCCCCTT---ATCTTGAGGCGCCGCCGCCACCGCATCA
:::::::::::.:::::::::.:::::::::::::.::::::.:::::::::::.::::::::::::.:   ::. : ::::. :...:.::.    . .
GTACTCCTCTACCTGGGGCTGCTACTGGCACCACTTTGTTGGTCCCCCACCCAGGAACCCCAGCCCCCTCCTATTGTCAGGCAACATTGTCATGCATCAG
-V--L--L--Y--L--G--L--L--L--A--P--L--C--W--S--P--T--Q--E--P--Q--P--P--P--I--V--R--Q--H--C--H--A--S--

------------------------------->
I--S--P--D--N--K--Y--P--P--V--*-
TATCCCCAGATAACAAATATCCTCCAGTCTAA
:::: ::::::::::::.::            
TATCACCAGATAACAAACAT------------
V--S--P--D--N--K--H-------------

Pig Consensus Sequence

>BGISUST0000897399
---GCTGCCCTGCACGTGCTCTACCCTCAGGTGTCCTGCTGTGGGCCTGTTTCCTGTACCTGCTGCCGGCATTCTAGGTGGCCTCCTCTCACAGAGTCTC
CTTGTACGCGgcTGTTCTACATTCTCCTCCATGTGGGGGCCTCAGCAGTCTGCTGCCTCCTATTGTCAAGG-----------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
GGGGTGGGGGAGAGGTGTTTCAGCAGCTCTGCTGCCAGCAGTCCTTTCCTATCTCCAGGGCAAAGAGGTGGGACTGCCAGGCCAGCTGACCAAGATACCT
CTCCAGCTCTTCCAGCGCAAGCCCAGCAGCTTTCCTACAGCTATTCTGCCTTCCACTTTGTCTTCTTCCTAGCATCACTCTATGTCATGGTTACCCTCAC
CAACTGGTTC---TATGAGGGAGCAGAACTGGAAAAGACGTTCACCATGGGTAGCTGGGCTACTTTCTGGGTCAAGGTTGCCTCATGCTGGGCCTGTGTA
CTCCTCTACCTGGGGCTGCTACTGGCACCACTTTGTTGGTCCCCCACCCAGGAACCCCAGCCCCCTCCTATTGTCAGGCAACATTGTCATGCATCAGTAT
CACCAGATAACAAA------------


>BGISUSP0000897399
-AALHVLYPQVSCCGPVSCTCCRHSRWPPLTESPCTRLFYILLHVGASAVCCLLLSR-------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
GVGERCFSSSAASSPFLSPGQRGGTARPADQDTSPALPAQAQQLSYSYSAFHFVFFLASLYVMVTLTNWF-YEGAELEKTFTMGSWATFWVKVASCWACV
LLYLGLLLAPLCWSPTQEPQPPPIVRQHCHASVSPDNK----