Sequences
EST Library Info
cst1Stomach - RNA from China
Clusters
Oligos
SNPs

Gene ID ENSG00000175782 (click for geneview)
Transcript ID ENST00000319429(link to ensembl)
Symbol SLC35E3
Localtion Chromosome:12:67426252:67445303:1 band: 12q15
Description solute carrier family 35, member E3 (SLC35E3), mRNA [Source:RefSeq_dna;Acc:NM_018656]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--L--L--G--Q--T--V--R--S--A--S--A--R--T--R--R--W--S--R--R--A--A--G--D--R--P--G--A--P--S--E--A--
ATGCCACTCCTGGGTCAGACGGTGAGGTCGGCGTCTGCGAGGACGCGGCGGTGGAGTAGAAGGGCAGCCGGAGACAGGCCCGGCGCCCCTTCCGAGGCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------><-------------------------------><----------------------------------
R--R--P--Q--L--R--G--D--H--G--I--V--D--R--V--R--G--H--W--R--I--A--G--S--C--S--T--C--W--C--P--S--A--L
GACGGCCCCAGCTTCGCGGGGATCATGGCATTGTGGACCGAGTGCGGGGCCACTGGCGAATCGCCGGCTCCTGTTCAACCTGCTGGTGTCCATCTGCATT
                                                                    :::::.:::::::::::::::::::::::::.
--------------------------------------------------------------------TCCTGCTCAACCTGCTGGTGTCCATCTGCATC
---------------------------------------------------------------------S--C--S--T--C--W--C--P--S--A--S

---------------------------------><-----------------------------------------------------------------
--C--S--S--T--N--G--F--M--C--T--T--F--P--N--M--S--L--T--L--V--H--F--V--V--T--W--L--G--L--Y--I--C--Q-
GTGTTCCTCAACAAATGGATTTATGTGTACCACGTTCCCCAACATGAGCCTGACCCTGGTGCACTTCGTGGTCACCTGGCTGGGCTTGTATATCTGCCAG
::::::::::::::::::::.::::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::..:::::::
GTGTTCCTCAACAAATGGATCTATGTGCACCACGTTCCCCAACATGAGCCTGACCCTGGTGCACTTCGTGGTCACTTGGCTGGGCTTGTATGCCTGCCAG
--C--S--S--T--N--G--S--M--C--T--T--F--P--N--M--S--L--T--L--V--H--F--V--V--T--W--L--G--L--Y--A--C--Q-

----------------------------------------------------------------------------------------------------
-K--L--D--I--F--A--P--K--S--L--P--P--S--R--L--L--L--L--A--L--S--F--C--G--F--V--V--F--T--N--L--S--L--
AAGCTGGACATCTTTGCCCCCAAAAGTCTGCCGCCCTCCAGGCTCCTCCTCCTGGCCCTCAGCTTCTGTGGCTTTGTGGTCTTCACTAACCTTTCTCTGC
:::::::::::::::::::::::::::::::::::.::::.::::::::::::::: :::::::::::::::::.:::::::::::.::..: :::::::
AAGCTGGACATCTTTGCCCCCAAAAGTCTGCCGCCTTCCAAGCTCCTCCTCCTGGCGCTCAGCTTCTGTGGCTTCGTGGTCTTCACCAATTTATCTCTGC
-K--L--D--I--F--A--P--K--S--L--P--P--S--K--L--L--L--L--A--L--S--F--C--G--F--V--V--F--T--N--L--S--L--

----------------------------------------------------------------------------------------------------
Q--N--N--T--I--G--T--Y--Q--L--A--K--A--M--T--T--P--V--I--I--A--I--Q--T--F--C--Y--Q--K--T--F--S--T--R
AGAACAACACCATAGGCACCTATCAGCTGGCCAAGGCCATGACCACGCCGGTGATCATAGCCATCCAGACCTTCTGCTACCAGAAAACCTTCTCCACCAG
:::::::::::::::::::::::::::::::.::::::::::::::.:::::::::::::.::::::::::.::: :::: :::::::::::::...::.
AGAACAACACCATAGGCACCTATCAGCTGGCTAAGGCCATGACCACACCGGTGATCATAGTCATCCAGACCCTCTTCTACAAGAAAACCTTCTCTGTCAA
Q--N--N--T--I--G--T--Y--Q--L--A--K--A--M--T--T--P--V--I--I--V--I--Q--T--L--F--Y--K--K--T--F--S--V--K

---------------><-----------------------------------------------------------------------------------
--I--Q--L--T--L--I--P--I--T--L--G--V--I--L--N--S--Y--Y--D--V--K--F--N--F--L--G--M--V--F--A--A--L--G-
AATCCAGCTCACGCTGATTCCTATAACTTTAGGTGTAATCCTAAATTCTTATTACGATGTGAAGTTTAATTTCCTTGGAATGGTGTTTGCTGCTCTTGGT
::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AATACAGCTCACGCTGATTCCTATAACTTTAGGTGTAATCCTAAATTCTTATTACGATGTGAAGTTTAATTTCCTTGGAATGGTGTTTGCTGCTCTTGGT
--I--Q--L--T--L--I--P--I--T--L--G--V--I--L--N--S--Y--Y--D--V--K--F--N--F--L--G--M--V--F--A--A--L--G-

--------------------------><------------------------------------------------------------------------
-V--L--V--T--S--L--Y--Q--V--W--V--G--A--K--Q--H--E--L--Q--V--N--S--M--Q--L--L--Y--Y--Q--A--P--M--S--
GTTTTAGTTACATCCCTTTATCAAGTGTGGGTAGGAGCCAAACAGCATGAATTACAAGTGAACTCAATGCAGCTGCTGTACTACCAGGCTCCGATGTCAT
:::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::.::.::::::::::::::::::::::::::.:: :::::::
GTTTTAGTTACATCCCTTTATCAAGTGTGGGTAGGAGCCAAACAGCATGAATTGCAAGTAAATTCAATGCAGCTGCTGTACTACCAGGCCCCTATGTCAT
-V--L--V--T--S--L--Y--Q--V--W--V--G--A--K--Q--H--E--L--Q--V--N--S--M--Q--L--L--Y--Y--Q--A--P--M--S--

-------------------------------------------------------------------------------------><-------------
S--A--M--L--L--V--A--V--P--F--F--E--P--V--F--G--E--G--G--I--F--G--P--W--S--V--S--A--L--L--M--V--L--L
CTGCCATGTTGCTGGTTGCTGTGCCCTTCTTTGAGCCAGTGTTTGGAGAAGGAGGAATATTTGGTCCCTGGTCAGTTTCTGCTTTGCTTATGGTGCTGCT
::::::::::::::::.::.:::::::::::::::::::::                                                           
CTGCCATGTTGCTGGTCGCCGTGCCCTTCTTTGAGCCAGTG-----------------------------------------------------------
S--A--M--L--L--V--A--V--P--F--F--E--P--V------------------------------------------------------------

--------------------------------------------------------------------><------------------------------
--S--G--V--I--A--F--M--V--N--L--S--I--Y--W--I--I--G--N--T--S--P--V--T--Y--N--M--F--G--H--F--K--F--C-
ATCTGGAGTAATAGCTTTCATGGTGAACTTATCAATTTATTGGATCATTGGGAACACTTCACCTGTCACCTATAACATGTTCGGACACTTCAAGTTCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--T--L--F--G--G--Y--V--L--F--K--D--P--L--S--I--N--Q--A--L--G--I--L--C--T--L--F--G--I--L--A--Y--T--
ATTACTTTATTCGGAGGATATGTTTTATTTAAGGATCCACTGTCCATTAATCAGGCCCTTGGCATTTTATGTACATTATTTGGCATTCTCGCCTATACCC
                                                                                             :::::::
---------------------------------------------------------------------------------------------TATACCC
----------------------------------------------------------------------------------------------Y--T--

------------------------------------------------------->
H--F--K--L--S--E--Q--E--G--S--R--S--K--L--A--Q--R--P--*-
ACTTTAAGCTCAGTGAACAGGAAGGAAGTAGGAGTAAACTGGCACAACGTCCTTAA
:.:::::.::::::::::::::::::::::.:::::::.:::.:::.:::::::::
ATTTTAAACTCAGTGAACAGGAAGGAAGTAAGAGTAAATTGGTACAGCGTCCTTAA
H--F--K--L--S--E--Q--E--G--S--K--S--K--L--V--Q--R--P--*-

Pig Consensus Sequence

>BGISUST0000882266
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------TCCTGCTCAACCTGCTGGTGTCCATCTGCATC
GTGTTCCTCAACAAATGGATCTATGTGCACCACGTTCCCCAACATGAGCCTGACCCTGGTGCACTTCGTGGTCACTTGGCTGGGCTTGTATGCCTGCCAG
AAGCTGGACATCTTTGCCCCCAAAAGTCTGCCGCCTTCCAAGCTCCTCCTCCTGGCGCTCAGCTTCTGTGGCTTCGTGGTCTTCACCAATTTATCTCTGC
AGAACAACACCATAGGCACCTATCAGCTGGCTAAGGCCATGACCACACCGGTGATCATAGTCATCCAGACCCTCTTCTACAAGAAAACCTTCTCTGTCAA
AATACAGCTCACGCTGATTCCTATAACTTTAGGTGTAATCCTAAATTCTTATTACGATGTGAAGTTTAATTTCCTTGGAATGGTGTTTGCTGCTCTTGGT
GTTTTAGTTACATCCCTTTATCAAGTGTGGGTAGGAGCCAAACAGCATGAATTGCAAGTAAATTCAATGCAGCTGCTGTACTACCAGGCCCCTATGTCAT
CTGCCATGTTGCTGGTCGCCGTGCCCTTCTTTGAGCCAGTG-----------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------------TATACCC
ATTTTAAACTCAGTGAACAGGAAGGAAGTAAGAGTAAATTGGTACAGCGTCCTTAA


>BGISUSP0000882266
--------------------------------------------------------SCSTCWCPSASCSSTNGSMCTTFPNMSLTLVHFVVTWLGLYACQ
KLDIFAPKSLPPSKLLLLALSFCGFVVFTNLSLQNNTIGTYQLAKAMTTPVIIVIQTLFYKKTFSVKIQLTLIPITLGVILNSYYDVKFNFLGMVFAALG
VLVTSLYQVWVGAKQHELQVNSMQLLYYQAPMSSAMLLVAVPFFEPV-----------------------------------------------------
-------------------------------YTHFKLSEQEGSKSKLVQRP*