Sequences
EST Library Info
cbr1Brain - RNA from China
cly1Lymph - RNA from China
ese1Foetus 50 days, M. semitendinosus
plac2Unavailable
sin2Small intestine
ste1M. Semitendinosus
ton3Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000176783 (click for geneview)
Transcript ID ENST00000319449(link to ensembl)
Symbol RUFY1
Localtion Chromosome:5:178910177:178969618:1 band: 5q35.3
Description RUN and FYVE domain containing protein 1 (FYVE-finger protein EIP1) (Zinc finger FYVE domain containing protein 12). [Source:Uniprot/SWISSPROT;Acc:Q96T51]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--M--E--E--R--A--N--L--M--H--M--M--K--L--S--I--K--V--L--L--Q--S--A--L--S--L--G--R--S--L--D--A--D--
ATGATGGAGGAGCGTGCCAACCTGATGCACATGATGAAACTCAGCATCAAGGTGTTGCTCCAGTCGGCTCTGAGCCTGGGCCGCAGCCTGGATGCGGACC
                                                                              ::::::::::::::::: ::::
------------------------------------------------------------------------------GGCCGCAGCCTGGATGCCGACC
-------------------------------------------------------------------------------G--R--S--L--D--A--D--

-----------------------------------------------------------><---------------------------------------
H--A--P--L--Q--Q--F--F--V--V--M--E--H--C--L--K--H--G--L--K--V--K--K--S--F--I--G--Q--N--K--S--F--F--G
ATGCCCCCTTGCAGCAGTTCTTTGTAGTGATGGAGCACTGCCTCAAACATGGGCTGAAAGTTAAGAAGAGTTTTATTGGCCAAAATAAATCATTCTTTGG
:::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::                                         
ATGCCCCTTTGCAGCAGTTCTTTGTAGTGATGGAGCACTGCCTCAAACATGGGCTGAAA-----------------------------------------
H--A--P--L--Q--Q--F--F--V--V--M--E--H--C--L--K--H--G--L--K------------------------------------------

-----------------------------------------------------------------------------><---------------------
--P--L--E--L--V--E--K--L--C--P--E--A--S--D--I--A--T--S--V--R--N--L--P--E--L--K--T--A--V--G--R--G--R-
TCCTTTGGAGCTGGTGGAGAAACTTTGTCCAGAAGCATCAGATATAGCGACTAGTGTCAGAAATCTTCCAGAATTAAAGACAGCTGTGGGAAGAGGCCGA
                            :::::::::::::::::::: ::::::::::::::::: :::::::::   ::::::::::::::.::: ::
----------------------------CCAGAAGCATCAGATATAGCCACTAGTGTCAGAAATCTGCCAGAATTA---ACAGCTGTGGGAAGGGGCAGA
-----------------------------P--E--A--S--D--I--A--T--S--V--R--N--L--P--E--L-----T--A--V--G--R--G--R-

-------------------------------------------------------------------------------><-------------------
-A--W--L--Y--L--A--L--M--Q--K--K--L--A--D--Y--L--K--V--L--I--D--N--K--H--L--L--S--E--F--Y--E--P--E--
GCGTGGCTTTATCTTGCACTCATGCAAAAGAAACTGGCAGATTATCTGAAAGTGCTTATAGACAATAAACATCTCTTAAGCGAGTTCTATGAGCCTGAGG
:: :::::::::::::: ::::::::.::::::::::::::::::::::::::::::::::::::::::::::::.::   :::::::::::::::::::
GCTTGGCTTTATCTTGCCCTCATGCAGAAGAAACTGGCAGATTATCTGAAAGTGCTTATAGACAATAAACATCTCCTA---GAGTTCTATGAGCCTGAGG
-A--W--L--Y--L--A--L--M--Q--K--K--L--A--D--Y--L--K--V--L--I--D--N--K--H--L--L-----E--F--Y--E--P--E--

----------------------------------------------------------------------------------------------------
A--L--M--M--E--E--E--G--M--V--I--V--G--L--L--V--G--L--N--V--L--D--A--N--L--C--L--K--G--E--D--L--D--S
CTTTAATGATGGAGGAAGAAGGGATGGTGATTGTTGGTCTGCTGGTGGGACTCAATGTTCTCGATGCCAATCTCTGCTTGAAAGGAGAAGACTTGGATTC
:.::. :::::::::::::::::::::: ::::::::::::::::::::.:::::.:: ::.::::: :::::::::::.::.:::::.:::        
CCTTGCTGATGGAGGAAGAAGGGATGGTCATTGTTGGTCTGCTGGTGGGGCTCAACGTGCTTGATGCGAATCTCTGCTTAAAGGGAGAGGAC--------
A--L--L--M--E--E--E--G--M--V--I--V--G--L--L--V--G--L--N--V--L--D--A--N--L--C--L--K--G--E--D---------

---><------------------------------------------------------------><---------------------------------
--Q--V--G--V--I--D--F--S--L--Y--L--K--D--V--Q--D--L--D--G--G--K--E--H--E--R--I--T--D--V--L--D--Q--K-
TCAGGTTGGAGTAATAGATTTTTCCCTCTACCTTAAGGATGTGCAGGATCTTGATGGTGGCAAGGAGCATGAAAGAATTACTGATGTCCTTGATCAAAAA
    ::::::::.:: ::::::::.::::::::.:::::::::::::::::::::::::::      :::::::::::::::::::::::::::::::::
----GTTGGAGTGATCGATTTTTCTCTCTACCTCAAGGATGTGCAGGATCTTGATGGTGGC------CATGAAAGAATTACTGATGTCCTTGATCAAAAA
-----V--G--V--I--D--F--S--L--Y--L--K--D--V--Q--D--L--D--G--G--------H--E--R--I--T--D--V--L--D--Q--K-

-------------------------------><-------------------------------------------------------------------
-N--Y--V--E--E--L--N--R--H--L--S--C--T--V--G--D--L--Q--T--K--I--D--G--L--E--K--T--N--S--K--L--Q--E--
AATTATGTGGAAGAACTTAACCGGCACTTGAGCTGCACAGTTGGGGATCTTCAAACCAAGATAGATGGCTTGGAAAAGACTAACTCAAAGCTTCAAGAAG
:::::.::::::::::: ::::::::::::   ::::::::.:::::::::::::::::::::::::::::::::::::::::.:::::::: :::::::
AATTACGTGGAAGAACTGAACCGGCACTTG---TGCACAGTCGGGGATCTTCAAACCAAGATAGATGGCTTGGAAAAGACTAATTCAAAGCTGCAAGAAG
-N--Y--V--E--E--L--N--R--H--L-----C--T--V--G--D--L--Q--T--K--I--D--G--L--E--K--T--N--S--K--L--Q--E--

-><-------------------------------------------------------------------------------------------------
E--L--S--A--A--T--D--R--I--C--S--L--Q--E--E--Q--Q--Q--L--R--E--Q--N--E--L--I--R--E--R--S--E--K--S--V
AGCTTTCAGCTGCAACAGACCGAATTTGCTCACTTCAAGAAGAACAGCAGCAGTTAAGAGAACAAAATGAATTAATTCGAGAAAGAAGTGAAAAGAGTGT
::::: ::::::::::::::::.:::::.::::::::::::::::::::.::.::.:::::::: ::.::::::::::: ::.:::::.::.::: : ::
AGCTTGCAGCTGCAACAGACCGGATTTGTTCACTTCAAGAAGAACAGCAACAATTGAGAGAACA-AACGAATTAATTCGTGAGAGAAGCGAGAAGCGAGT
E--L--A--A--A--T--D--R--I--C--S--L--Q--E--E--Q--Q--Q--L--R--E--Q--N--E--L--I--R--E--R--S--E--K--R--V

------><--------------------------------------------------------------------------------------------
--E--I--T--K--Q--D--T--K--V--E--L--E--T--Y--K--Q--T--R--Q--G--L--D--E--M--Y--S--D--V--W--K--Q--L--K-
AGAGATAACAAAACAGGATACCAAAGTTGAGCTGGAGACTTACAAGCAAACTCGGCAAGGTCTGGATGAAATGTACAGTGATGTGTGGAAGCAGCTAAAA
::::::::::::::::::::: ::::::::::::::::::::::::::.:: ::::::::::::::.::::::::::::::::::::::::::::::::.
AGAGATAACAAAACAGGATACAAAAGTTGAGCTGGAGACTTACAAGCAGACACGGCAAGGTCTGGACGAAATGTACAGTGATGTGTGGAAGCAGCTAAAG
--E--I--T--K--Q--D--T--K--V--E--L--E--T--Y--K--Q--T--R--Q--G--L--D--E--M--Y--S--D--V--W--K--Q--L--K-

-----------------------><---------------------------------------------------------------------------
-E--E--K--K--V--R--L--E--L--E--K--E--L--E--L--Q--I--G--M--K--T--E--M--E--I--A--M--K--L--L--E--K--D--
GAGGAGAAGAAAGTCCGGTTGGAACTGGAAAAAGAACTGGAGTTACAAATTGGAATGAAAACCGAAATGGAAATTGCAATGAAGTTACTGGAAAAGGACA
:::::::::::.:. :: ::::::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::..::::.::::::::::
GAGGAGAAGAAGGCGCGCTTGGAACTAGAAAAAGAACTGGAGTTACAAATTGGAATGAAAACTGAAATGGAAATTGCAATGAAACTACTAGAAAAGGACA
-E--E--K--K--A--R--L--E--L--E--K--E--L--E--L--Q--I--G--M--K--T--E--M--E--I--A--M--K--L--L--E--K--D--

-------------------------------------------------------------------------------------------><-------
T--H--E--K--Q--D--T--L--V--A--L--R--Q--Q--L--E--E--V--K--A--I--N--L--Q--M--F--H--K--A--Q--N--A--E--S
CCCACGAGAAGCAGGACACACTAGTTGCCCTCCGCCAGCAGCTGGAAGAAGTCAAAGCGATTAATTTACAGATGTTTCACAAAGCTCAGAATGCAGAGAG
::::::::::::::::::::::::::::::: ::::::::::::::::: ::::::::::::::::::::::::::::::::::.:::::::::::::::
CCCACGAGAAGCAGGACACACTAGTTGCCCTGCGCCAGCAGCTGGAAGACGTCAAAGCGATTAATTTACAGATGTTTCACAAAGTTCAGAATGCAGAGAG
T--H--E--K--Q--D--T--L--V--A--L--R--Q--Q--L--E--D--V--K--A--I--N--L--Q--M--F--H--K--V--Q--N--A--E--S

-----------------------------------------------------------------------------------------><---------
--S--L--Q--Q--K--N--E--A--I--T--S--F--E--G--K--T--N--Q--V--M--S--S--M--K--Q--M--E--E--R--L--Q--H--S-
CAGTTTGCAGCAGAAGAATGAAGCCATCACATCCTTTGAAGGAAAAACCAACCAAGTTATGTCCAGCATGAAACAAATGGAAGAAAGGTTGCAGCACTCG
::::::.::.:::::::::::::::::::::::.:::::::.::::: .::.:::::::::::::::::::::::.:::::::::   ::.:: ::: :.
CAGTTTACAACAGAAGAATGAAGCCATCACATCTTTTGAAGAAAAAAATAATCAAGTTATGTCCAGCATGAAACAGATGGAAGAA---TTACACCACGCA
--S--L--Q--Q--K--N--E--A--I--T--S--F--E--E--K--N--N--Q--V--M--S--S--M--K--Q--M--E--E-----L--H--H--A-

----------------------------------------------------------------------------------------------------
-E--R--A--R--Q--G--A--E--E--R--S--H--K--L--Q--Q--E--L--G--G--R--I--G--A--L--Q--L--Q--L--S--Q--L--H--
GAGCGGGCGAGGCAGGGGGCTGAGGAGCGGAGCCACAAGCTGCAGCAGGAGCTGGGCGGGAGGATCGGCGCCCTGCAGCTGCAGCTCTCCCAGCTGCACG
::::::::.:::::::: ::.:::::::::::::: :::::::::::::::::::::::: :::.:.:::::::::::: ::::::: :::::::.::: 
GAGCGGGCAAGGCAGGGCGCCGAGGAGCGGAGCCAGAAGCTGCAGCAGGAGCTGGGCGGGCGGACCAGCGCCCTGCAGCAGCAGCTCGCCCAGCTACACC
-E--R--A--R--Q--G--A--E--E--R--S--Q--K--L--Q--Q--E--L--G--G--R--T--S--A--L--Q--Q--Q--L--A--Q--L--H--

---------><-----------------------------------------------------------------------------------------
E--Q--C--S--S--L--E--K--E--L--K--S--E--K--E--Q--R--Q--A--L--Q--R--E--L--Q--H--E--K--D--T--S--S--L--L
AGCAATGCTCAAGCCTGGAGAAAGAATTGAAATCAGAAAAAGAGCAAAGACAGGCTCTTCAGCGCGAATTACAGCACGAGAAAGACACTTCCTCTCTACT
::      :::::.::.::::::::.::::::::::::::::::::::::::.::::::::::: ::::::: .::.:::::::::::::::::::: ::
AG------TCAAGTCTAGAGAAAGAGTTGAAATCAGAAAAAGAGCAAAGACAAGCTCTTCAGCGAGAATTACTACATGAGAAAGACACTTCCTCTCTCCT
Q--------S--S--L--E--K--E--L--K--S--E--K--E--Q--R--Q--A--L--Q--R--E--L--L--H--E--K--D--T--S--S--L--L

---------------------------------------><-----------------------------------------------------------
--R--M--E--L--Q--Q--V--E--G--L--K--K--E--L--R--E--L--Q--D--E--K--A--E--L--Q--K--I--C--E--E--Q--E--Q-
CAGGATGGAGCTGCAACAAGTGGAAGGACTGAAAAAGGAGTTGCGGGAGCTTCAGGACGAGAAGGCAGAGCTGCAGAAGATCTGCGAGGAGCAGGAACAA
: .... :::::.::::::::.::::::.:.:::::::::.::::::::::.::::::::::::::::::.:.::::::.:.::.:: ::::::::::::
CCAAGCCGAGCTACAACAAGTAGAAGGATTAAAAAAGGAGCTGCGGGAGCTCCAGGACGAGAAGGCAGAGTTACAGAAGGTTTGTGACGAGCAGGAACAA
--Q--A--E--L--Q--Q--V--E--G--L--K--K--E--L--R--E--L--Q--D--E--K--A--E--L--Q--K--V--C--D--E--Q--E--Q-

----------------------------------><-----------------------------------------------><---------------
-A--L--Q--E--M--G--L--H--L--S--Q--S--K--L--K--M--E--D--I--K--E--V--N--Q--A--L--K--G--H--A--W--L--K--
GCCCTCCAGGAAATGGGCCTGCACCTCAGCCAGTCCAAGCTGAAGATGGAAGATATAAAAGAAGTGAACCAGGCACTGAAGGGCCACGCCTGGCTGAAAG
:::::::::::::::::.::.:::::::::                                                   ::::::.:::::.::::::
GCCCTCCAGGAAATGGGTCTACACCTCAGC---------------------------------------------------GGCCACACCTGGTTGAAAG
-A--L--Q--E--M--G--L--H--L--S-----------------------------------------------------G--H--T--W--L--K--

-------------------------------------------------------------><-------------------------------------
D--D--E--A--T--H--C--R--Q--C--E--K--E--F--S--I--S--R--R--K--H--H--C--R--N--C--G--H--I--F--C--N--T--C
ATGACGAAGCGACACACTGTAGGCAGTGTGAGAAGGAGTTCTCCATTTCCCGGAGAAAGCACCACTGCCGGAACTGTGGCCACATCTTCTGCAACACCTG
::::.:::::.::::::::::.:::::::::.::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::: ::
ATGATGAAGCAACACACTGTAAGCAGTGTGAAAAGGAGTTCTCCATTTCCCGGAGAAAGCACCACTGCCGAAACTGTGGCCACATCTTCTGCAACACATG
D--D--E--A--T--H--C--K--Q--C--E--K--E--F--S--I--S--R--R--K--H--H--C--R--N--C--G--H--I--F--C--N--T--C

----------------------------------------------------------------------------------------------------
--S--S--N--E--L--A--L--P--S--Y--P--K--P--V--R--V--C--D--S--C--H--T--L--L--L--Q--R--C--S--S--T--A--S-
CTCCAGCAACGAGCTGGCCCTGCCCTCCTACCCCAAGCCGGTGCGAGTGTGCGACAGCTGCCACACCCTGCTCCTGCAGCGCTGCTCCTCCACGGCCTCC
.:::::.::.::::::::::::::::::::.::::::::.::::: :::::.::::::::::::::::::::::: ::.::.::::::::: :       
TTCCAGTAATGAGCTGGCCCTGCCCTCCTATCCCAAGCCAGTGCGTGTGTGTGACAGCTGCCACACCCTGCTCCTTCAACGTTGCTCCTCCTCC------
--S--S--N--E--L--A--L--P--S--Y--P--K--P--V--R--V--C--D--S--C--H--T--L--L--L--Q--R--C--S--S--S-------

---
-*-
TGA
   
---
---

Pig Consensus Sequence

>BGISUST0000895184
------------------------------------------------------------------------------GGCCGCAGCCTGGATGCCGACC
ATGCCCCTTTGCAGCAGTTCTTTGTAGTGATGGAGCACTGCCTCAAACATGGGCTGAAA-----------------------------------------
----------------------------CCAGAAGCATCAGATATAGCCACTAGTGTCAGAAATCTGCCAGAATTA---ACAGCTGTGGGAAGGGGCAGA
GCTTGGCTTTATCTTGCCCTCATGCAGAAGAAACTGGCAGATTATCTGAAAGTGCTTATAGACAATAAACATCTCCTA---GAGTTCTATGAGCCTGAGG
CCTTGCTGATGGAGGAAGAAGGGATGGTCATTGTTGGTCTGCTGGTGGGGCTCAACGTGCTTGATGCGAATCTCTGCTTAAAGGGAGAGGAC--------
----GTTGGAGTGATCGATTTTTCTCTCTACCTCAAGGATGTGCAGGATCTTGATGGTGGC------CATGAAAGAATTACTGATGTCCTTGATCAAAAA
AATTACGTGGAAGAACTGAACCGGCACTTG---TGCACAGTCGGGGATCTTCAAACCAAGATAGATGGCTTGGAAAAGACTAATTCAAAGCTGCAAGAAG
AGCTTGCAGCTGCAACAGACCGGATTTGTTCACTTCAAGAAGAACAGCAACAATTGAGAGAaaACGAATTAATTCGTGAGAGAAGCGAGAAGCGAGTAGA
GATAACAAAACAGGATACAAAAGTTGAGCTGGAGACTTACAAGCAGACACGGCAAGGTCTGGACGAAATGTACAGTGATGTGTGGAAGCAGCTAAAGGAG
GAGAAGAAGGCGCGCTTGGAACTAGAAAAAGAACTGGAGTTACAAATTGGAATGAAAACTGAAATGGAAATTGCAATGAAACTACTAGAAAAGGACACCC
ACGAGAAGCAGGACACACTAGTTGCCCTGCGCCAGCAGCTGGAAGACGTCAAAGCGATTAATTTACAGATGTTTCACAAAGTTCAGAATGCAGAGAGCAG
TTTACAACAGAAGAATGAAGCCATCACATCTTTTGAAGAAAAAAATAATCAAGTTATGTCCAGCATGAAACAGATGGAAGAA---TTACACCACGCAGAG
CGGGCAAGGCAGGGCGCCGAGGAGCGGAGCCAGAAGCTGCAGCAGGAGCTGGGCGGGCGGACCAGCGCCCTGCAGCAGCAGCTCGCCCAGCTACACCAG-
-----TCAAGTCTAGAGAAAGAGTTGAAATCAGAAAAAGAGCAAAGACAAGCTCTTCAGCGAGAATTACTACATGAGAAAGACACTTCCTCTCTCCTCCA
AGCCGAGCTACAACAAGTAGAAGGATTAAAAAAGGAGCTGCGGGAGCTCCAGGACGAGAAGGCAGAGTTACAGAAGGTTTGTGACGAGCAGGAACAAGCC
CTCCAGGAAATGGGTCTACACCTCAGC---------------------------------------------------GGCCACACCTGGTTGAAAGATG
ATGAAGCAACACACTGTAAGCAGTGTGAAAAGGAGTTCTCCATTTCCCGGAGAAAGCACCACTGCCGAAACTGTGGCCACATCTTCTGCAACACATGTTC
CAGTAATGAGCTGGCCCTGCCCTCCTATCCCAAGCCAGTGCGTGTGTGTGACAGCTGCCACACCCTGCTCCTTCAACGTTGCTCCTCCTCC---------


>BGISUSP0000895184
--------------------------GRSLDADHAPLQQFFVVMEHCLKHGLK-----------------------PEASDIATSVRNLPEL-TAVGRGR
AWLYLALMQKKLADYLKVLIDNKHLL-EFYEPEALLMEEEGMVIVGLLVGLNVLDANLCLKGED----VGVIDFSLYLKDVQDLDGG--HERITDVLDQK
NYVEELNRHL-CTVGDLQTKIDGLEKTNSKLQEELAAATDRICSLQEEQQQLRENELIRERSEKRVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKE
EKKARLELEKELELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEDVKAINLQMFHKVQNAESSLQQKNEAITSFEEKNNQVMSSMKQMEE-LHHAE
RARQGAEERSQKLQQELGGRTSALQQQLAQLHQ--SSLEKELKSEKEQRQALQRELLHEKDTSSLLQAELQQVEGLKKELRELQDEKAELQKVCDEQEQA
LQEMGLHLS-----------------GHTWLKDDEATHCKQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSS---