Sequences
EST Library Info
cki1Kidney - RNA from China
cmu2Rhinal mucous membrane - RNA from China
csp2Spleen - RNA from China
fce2Foetus 100 days, cerebellum
hyp1Hypothalamus
lnt1Lymphatic nodule tracheobroncalis
nbm2Newborn 115 days, bone marrow (pelvis)
nco1Newborn 115 days, colon
spl1Spleen
sto1Stomach
Clusters
Oligos
SNPs

Gene ID ENSG00000124655 (click for geneview)
Transcript ID ENST00000319627(link to ensembl)
Symbol AIF1
Localtion Chromosome:6:31690987:31692770:1 band: 6p21.33
Description Allograft inflammatory factor-1 (AIF-1) (Ionized calcium-binding adapter molecule 1) (G1 protein). [Source:Uniprot/SWISSPROT;Acc:P55008]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------><------------------------------------------------------------><------------
-M--S--Q--T--R--D--L--Q--G--G--K--A--F--G--L--L--K--A--Q--Q--E--E--R--L--D--E--I--N--K--Q--F--L--D--
ATGAGCCAAACCAGGGATTTACAGGGAGGAAAAGCTTTCGGACTGCTGAAGGCCCAGCAGGAAGAGAGGCTGGATGAGATCAACAAGCAATTCCTAGACG
                           ::::::::.:::::.::::::::::::::::::::::::::.:: .::::.:::::.:::::::::::.::.:
---------------------------GGAAAAGCCTTCGGGCTGCTGAAGGCCCAGCAGGAAGAGAGACTCAATGAAATCAATAAGCAATTCCTGGATG
----------------------------G--K--A--F--G--L--L--K--A--Q--Q--E--E--R--L--N--E--I--N--K--Q--F--L--D--

-----------------------------------------------------><----------------------------------------><---
D--P--K--Y--S--S--D--E--D--L--P--S--K--L--E--G--F--K--E--K--Y--M--E--F--D--L--N--G--N--G--D--I--D--I
ATCCCAAATATAGCAGTGATGAGGATCTGCCCTCCAAACTGGAAGGCTTCAAAGAGAAATACATGGAGTTTGACCTTAATGGAAATGGCGATATTGATAT
:::::::::::::::::::::::::.:::.::::::::::::::: :::::::   :::::::::::::::::::: :::::::::::.::::::   ::
ATCCCAAATATAGCAGTGATGAGGACCTGTCCTCCAAACTGGAAGCCTTCAAA---AAATACATGGAGTTTGACCTGAATGGAAATGGTGATATT---AT
D--P--K--Y--S--S--D--E--D--L--S--S--K--L--E--A--F--K-----K--Y--M--E--F--D--L--N--G--N--G--D--I-----I

----------------------------------------------------------------------------------------------------
--M--S--L--K--R--M--L--E--K--L--G--V--P--K--T--H--L--E--L--K--K--L--I--G--E--V--S--S--G--S--G--E--T-
CATGTCCCTGAAACGAATGCTGGAGAAACTTGGAGTCCCCAAGACTCACCTAGAGCTAAAGAAATTAATTGGAGAGGTGTCCAGTGGCTCCGGGGAGACG
.::::::::::::::::::::::::::.:::::.:::::::::::.:::::.:::::::::::::::::....:::::.:::::::::::.:::::::: 
TATGTCCCTGAAACGAATGCTGGAGAAGCTTGGGGTCCCCAAGACCCACCTGGAGCTAAAGAAATTAATCAAGGAGGTATCCAGTGGCTCTGGGGAGACT
--M--S--L--K--R--M--L--E--K--L--G--V--P--K--T--H--L--E--L--K--K--L--I--K--E--V--S--S--G--S--G--E--T-

----------------------------------------------------------><----------------------------------------
-F--S--Y--P--D--F--L--R--M--M--L--G--K--R--S--A--I--L--K--M--I--L--M--Y--E--E--K--A--R--E--K--E--K--
TTCAGCTACCCTGACTTTCTCAGGATGATGCTGGGCAAGAGATCTGCCATCCTAAAAATGATCCTGATGTATGAGGAAAAAGCGAGAGAAAAGGAAAAGC
:::::::::.::::::::::::.:::::::.::::::::::::::::::::::::::   :::::::::::.::.::.:::::::::::: :::::::::
TTCAGCTACTCTGACTTTCTCAAGATGATGTTGGGCAAGAGATCTGCCATCCTAAAA---ATCCTGATGTACGAAGAGAAAGCGAGAGAACAGGAAAAGC
-F--S--Y--S--D--F--L--K--M--M--L--G--K--R--S--A--I--L--K-----I--L--M--Y--E--E--K--A--R--E--Q--E--K--

------------------------------------------->
P--T--G--P--P--A--K--K--A--I--S--E--L--P--*-
CAACAGGCCCCCCAGCCAAGAAAGCTATCTCTGAGTTGCCCTGA
::::.::.::.::.::::::::.:::::::::::::::::::::
CAACGGGTCCTCCGGCCAAGAAGGCTATCTCTGAGTTGCCCTGA
P--T--G--P--P--A--K--K--A--I--S--E--L--P--*-

Pig Consensus Sequence

>BGISUST0000901625
---------------------------GGAAAAGCCTTCGGGCTGCTGAAGGCCCAGCAGGAAGAGAGACTCAATGAAATCAATAAGCAATTCCTGGATG
ATCCCAAATATAGCAGTGATGAGGACCTGTCCTCCAAACTGGAAGCCTTCAAA---AAATACATGGAGTTTGACCTGAATGGAAATGGTGATATT---AT
TATGTCCCTGAAACGAATGCTGGAGAAGCTTGGGGTCCCCAAGACCCACCTGGAGCTAAAGAAATTAATCAAGGAGGTATCCAGTGGCTCTGGGGAGACT
TTCAGCTACTCTGACTTTCTCAAGATGATGTTGGGCAAGAGATCTGCCATCCTAAAA---ATCCTGATGTACGAAGAGAAAGCGAGAGAACAGGAAAAGC
CAACGGGTCCTCCGGCCAAGAAGGCTATCTCTGAGTTGCCCTGA


>BGISUSP0000901625
---------GKAFGLLKAQQEERLNEINKQFLDDPKYSSDEDLSSKLEAFK-KYMEFDLNGNGDI-IMSLKRMLEKLGVPKTHLELKKLIKEVSSGSGET
FSYSDFLKMMLGKRSAILK-ILMYEEKAREQEKPTGPPAKKAISELP*