Sequences
EST Library Info
mcp1Mammae, collostrum producing
Clusters
Oligos
SNPs

Gene ID ENSG00000179841 (click for geneview)
Transcript ID ENST00000320636(link to ensembl)
Symbol AKAP5
Localtion Chromosome:14:64003578:64006178:1 band: 14q23.3
Description A-kinase anchor protein 5 (A-kinase anchor protein 79 kDa) (AKAP 79) (cAMP-dependent protein kinase regulatory subunit II high affinity binding protein) (H21). [Source:Uniprot/SWISSPROT;Acc:P24588]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--T--T--I--S--E--I--H--V--E--N--K--D--E--K--R--S--A--E--G--S--P--G--A--E--R--Q--K--E--K--A--S--
ATGGAAACCACAATTTCAGAAATTCATGTAGAAAACAAGGATGAGAAGAGATCAGCAGAAGGTAGTCCTGGGGCTGAAAGGCAGAAGGAAAAGGCATCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
M--L--C--F--K--R--R--K--K--A--A--K--A--L--K--P--K--A--G--S--E--A--A--D--V--A--R--K--C--P--Q--E--A--G
TGCTTTGCTTCAAGAGAAGAAAGAAAGCAGCCAAAGCACTGAAGCCCAAAGCTGGCTCTGAAGCTGCTGATGTGGCAAGGAAGTGTCCACAAGAAGCAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--S--D--Q--P--E--P--T--R--G--A--W--A--S--L--K--R--L--V--T--R--R--K--R--S--E--S--S--K--Q--Q--K--P-
AGCTTCTGATCAGCCAGAGCCCACACGGGGGGCCTGGGCCTCACTCAAACGTCTTGTAACACGCAGGAAAAGGTCAGAGTCTTCAAAGCAGCAAAAGCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--E--G--E--M--Q--P--A--I--N--A--E--D--A--D--L--S--K--K--K--A--K--S--R--L--K--I--P--C--I--K--F--P--
TTGGAGGGTGAAATGCAACCTGCAATAAATGCTGAGGATGCTGATCTTTCTAAGAAAAAGGCAAAATCTAGACTTAAGATTCCCTGCATAAAATTCCCAA
                                                         :.:::::::::.:::::.:::::::::::::::::::::.:::
---------------------------------------------------------AGGGCAAAATCCAGACTCAAGATTCCCTGCATAAAATTCTCAA
----------------------------------------------------------R--A--K--S--R--L--K--I--P--C--I--K--F--S--

----------------------------------------------------------------------------------------------------
R--G--P--K--R--S--N--H--S--K--I--I--E--D--S--D--C--S--I--K--V--Q--E--E--A--E--I--L--D--I--Q--T--Q--T
GAGGGCCAAAAAGGAGTAATCATTCCAAAATTATAGAAGACTCAGACTGCAGCATCAAAGTCCAGGAAGAAGCTGAAATTTTGGATATACAAACACAGAC
.:: :  .:::::.:::::::::::::::::::::::::::::::::::::::::.::::::::::::::.::::::: :::::::::: :::: : ...
AAGTGGGGAAAAGAAGTAATCATTCCAAAATTATAGAAGACTCAGACTGCAGCATTAAAGTCCAGGAAGAGGCTGAAAGTTTGGATATAAAAACTCCAGT
K--V--G--K--R--S--N--H--S--K--I--I--E--D--S--D--C--S--I--K--V--Q--E--E--A--E--S--L--D--I--K--T--P--V

----------------------------------------------------------------------------------------------------
--P--L--N--D--Q--A--T--K--A--K--S--T--Q--D--L--S--E--G--I--S--R--K--D--G--D--E--V--C--E--S--N--V--S-
CCCATTGAATGATCAGGCAACAAAGGCTAAGTCAACCCAGGATCTAAGTGAAGGCATCTCACGGAAAGATGGTGATGAGGTCTGTGAATCAAATGTGAGC
:: .:::.::::.:::::::::::..:.::::::::.: :::: :::: ::::...::::::.:::::::::::::::::::::::::::::::::::.:
CCAGTTGGATGACCAGGCAACAAAAACCAAGTCAACTCTGGATATAAGGGAAGATGTCTCACAGAAAGATGGTGATGAGGTCTGTGAATCAAATGTGAAC
--Q--L--D--D--Q--A--T--K--T--K--S--T--L--D--I--R--E--D--V--S--Q--K--D--G--D--E--V--C--E--S--N--V--N-

----------------------------------------------------------------------------------------------------
-N--S--T--T--S-----G--E--K--V--I--S--V--E--L--G--L--D--N--G--H--S--A--I--Q--T--G--T--L--I--L--E-----
AATAGCACAACTTCT---GGAGAGAAAGTGATTTCAGTAGAACTTGGATTAGATAATGGGCATTCTGCTATTCAAACGGGAACTCTAATCCTTGAA---G
:: ::::.:::::::   :::::.::::::::::::::::::::::..::::.::  :::::::::::::::: ::: ::::: ::::::::::::   :
AAGAGCATAACTTCTCCTGGAGAAAAAGTGATTTCAGTAGAACTTGAGTTAGGTACGGGGCATTCTGCTATTCCAACCGGAACGCTAATCCTTGAAAAAG
-K--S--I--T--S--P--G--E--K--V--I--S--V--E--L--E--L--G--T--G--H--S--A--I--P--T--G--T--L--I--L--E--K--

----------------------------------------------------------------------------------------------------
E--I--E--T--I--K--E--K--Q--D--V--Q--P--Q--Q--A--S--P--L--E--T--S--E--T--D--H--Q--Q--P--V--L--S--D--V
AAATTGAAACGATCAAGGAAAAACAAGATGTTCAACCCCAGCAAGCAAGCCCACTTGAAACTTCAGAAACAGACCATCAGCAGCCAGTACTTTCTGATGT
: ::::::::::...:.::::::: :....:::: ::.::::::: .:::::::: :::::.::::: :.::: ::::  :  :::::. ::::::::::
ATATTGAAACGACTGAAGAAAAACCAAGCATTCATCCTCAGCAAGGGAGCCCACTGGAAACCTCAGACATAGAACATCCCCTCCCAGTGGTTTCTGATGT
D--I--E--T--T--E--E--K--P--S--I--H--P--Q--Q--G--S--P--L--E--T--S--D--I--E--H--P--L--P--V--V--S--D--V

----------------------------------------------------------------------------------------------------
--P--P--L--P--A--I--P--D--Q--Q--I--V--E--E--A--S--N--S--T--L--E--S--A--P--N--G--K--D--Y--E--S--T--E-
TCCTCCTTTACCTGCAATTCCAGATCAACAAATTGTGGAAGAAGCCAGTAACAGTACCCTAGAAAGTGCACCAAATGGAAAAGACTATGAAAGTACAGAG
::::::.:::::::::.:.:::::::::::::: :::::::::::::: :.:::::.:::: :::::: ::::.::::.::::::.:.::::::: ::::
TCCTCCCTTACCTGCAGTCCCAGATCAACAAATGGTGGAAGAAGCCAGAAGCAGTATCCTATAAAGTGGACCAGATGGGAAAGACCACGAAAGTAGAGAG
--P--P--L--P--A--V--P--D--Q--Q--M--V--E--E--A--R--S--S--I--L--*--S--G--P--D--G--K--D--H--E--S--R--E-

----------------------------------------------------------------------------------------------------
-I--V--A--E--E--T--K--P--K--D--T--E--L--S--Q--E--S--D--F--K--E--N--G--I--T--E--E--K--S--K--S--E--E--
ATTGTAGCTGAAGAAACTAAGCCAAAAGATACTGAATTGAGCCAAGAATCAGATTTTAAAGAAAATGGGATCACTGAAGAGAAATCCAAATCAGAAGAAA
:: ::::::::.::.: ::::::::::                                                                         
ATGGTAGCTGAGGAGAGTAAGCCAAAA-------------------------------------------------------------------------
-M--V--A--E--E--S--K--P--K--------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--K--R--M--E--P--I--A--I--I--I--T--D--T--E--I--S--E--F--D--V--T--K--S--K--N--V--P--K--Q--F--L--I--S
GCAAAAGAATGGAGCCAATTGCTATTATTATTACAGACACTGAAATCAGTGAATTTGATGTTACAAAATCTAAAAATGTCCCTAAGCAATTCTTAATTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--E--N--E--Q--V--G--V--F--A--N--D--N--G--F--E--D--R--T--S--E--Q--Y--E--T--L--L--I--E--T--A--S--S-
AGCTGAAAATGAGCAAGTAGGGGTTTTTGCTAATGATAATGGTTTTGAGGATAGAACTTCAGAACAATATGAAACACTCTTAATTGAAACAGCCTCTTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------->
-L--V--K--N--A--I--Q--L--S--I--E--Q--L--V--N--E--M--A--S--D--D--N--K--I--N--N--L--L--Q--*-
CTAGTCAAGAATGCTATTCAGTTGTCAATAGAACAGCTGGTTAATGAAATGGCCTCTGATGATAATAAAATAAACAATCTTCTACAGTGA
                                                                                          
------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000876401
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------AGGGCAAAATCCAGACTCAAGATTCCCTGCATAAAATTCTCAA
AAGTGGGGAAAAGAAGTAATCATTCCAAAATTATAGAAGACTCAGACTGCAGCATTAAAGTCCAGGAAGAGGCTGAAAGTTTGGATATAAAAACTCCAGT
CCAGTTGGATGACCAGGCAACAAAAACCAAGTCAACTCTGGATATAAGGGAAGATGTCTCACAGAAAGATGGTGATGAGGTCTGTGAATCAAATGTGAAC
AAGAGCATAACTTCTCCTGGAGAAAAAGTGATTTCAGTAGAACTTGAGTTAGGTACGGGGCATTCTGCTATTCCAACCGGAACGCTAATCCTTGAAAAAG
ATATTGAAACGACTGAAGAAAAACCAAGCATTCATCCTCAGCAAGGGAGCCCACTGGAAACCTCAGACATAGAACATCCCCTCCCAGTGGTTTCTGATGT
TCCTCCCTTACCTGCAGTCCCAGATCAACAAATGGTGGAAGAAGCCAGAAGCAGTATCCTATAAAGTGGACCAGATGGGAAAGACCACGAAAGTAGAGAG
ATGGTAGCTGAGGAGAGTAAG-------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------


>BGISUSP0000876401
----------------------------------------------------------------------------------------------------
-------------------RAKSRLKIPCIKFSKVGKRSNHSKIIEDSDCSIKVQEEAESLDIKTPVQLDDQATKTKSTLDIREDVSQKDGDEVCESNVN
KSITSPGEKVISVELELGTGHSAIPTGTLILEKDIETTEEKPSIHPQQGSPLETSDIEHPLPVVSDVPPLPAVPDQQMVEEARSSIL*SGPDGKDHESRE
MVAEESK---------------------------------------------------------------------------------------------
----------------------------