Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000181072 (click for geneview)
Transcript ID ENST00000320658(link to ensembl)
Symbol CHRM2
Localtion Chromosome:7:136010671:136162254:1 band: 7q33
Description Muscarinic acetylcholine receptor M2. [Source:Uniprot/SWISSPROT;Acc:P08172]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--N--N--S--T--N--S--S--N--N--S--L--A--L--T--S--P--Y--K--T--F--E--V--V--F--I--V--L--V--A--G--S--L--
ATGAATAACTCAACAAACTCCTCTAACAATAGCCTGGCTCTTACAAGTCCTTATAAGACATTTGAAGTGGTGTTTATTGTCCTGGTGGCTGGATCCCTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--L--V--T--I--I--G--N--I--L--V--M--V--S--I--K--V--N--R--H--L--Q--T--V--N--N--Y--F--L--F--S--L--A--C
GTTTGGTGACCATTATCGGGAACATCCTAGTCATGGTTTCCATTAAAGTCAACCGCCACCTCCAGACCGTCAACAATTACTTTTTATTCAGCTTGGCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--D--L--I--I--G--V--F--S--M--N--L--Y--T--L--Y--T--V--I--G--Y--W--P--L--G--P--V--V--C--D--L--W--L-
TGCTGACCTTATCATAGGTGTTTTCTCCATGAACTTGTACACCCTCTACACTGTGATTGGTTACTGGCCTTTGGGACCTGTGGTGTGTGACCTTTGGCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--L--D--Y--V--V--S--N--A--S--V--M--N--L--L--I--I--S--F--D--R--Y--F--C--V--T--K--P--L--T--Y--P--V--
GCCCTGGACTATGTGGTCAGCAATGCCTCAGTTATGAATCTGCTCATCATCAGCTTTGACAGGTACTTCTGTGTCACAAAACCTCTGACCTACCCAGTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--R--T--T--K--M--A--G--M--M--I--A--A--A--W--V--L--S--F--I--L--W--A--P--A--I--L--F--W--Q--F--I--V--G
AGCGGACCACAAAAATGGCAGGTATGATGATTGCAGCTGCCTGGGTCCTCTCTTTCATCCTCTGGGCTCCAGCCATTCTCTTCTGGCAGTTCATTGTAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--R--T--V--E--D--G--E--C--Y--I--Q--F--F--S--N--A--A--V--T--F--G--T--A--I--A--A--F--Y--L--P--V--I-
GGTGAGAACTGTGGAGGATGGGGAGTGCTACATTCAGTTTTTTTCCAATGCTGCTGTCACCTTTGGTACGGCTATTGCAGCCTTCTATTTGCCAGTGATC
                                                                         :::::::::::::::::::: ::: . 
-------------------------------------------------------------------------ATTGCAGCCTTCTATTTGCCTGTGTC-
--------------------------------------------------------------------------I--A--A--F--Y--L--P--V--I-

----------------------------------------------------------------------------------------------------
-I--M--T--V--L--Y--W--H--I--S--R--A--S--K--S--R--I--K--K--D--K--K--E--P--V--A--N--Q--D--P--V--S--P--
ATCATGACTGTGCTATATTGGCACATATCCCGAGCCAGCAAGAGCAGGATAAAGAAGGACAAGAAGGAGCCTGTTGCCAACCAAGACCCCGTTTCTCCAA
:::::::::::..::::.::::::::::::::::::::.::::::::::: ::::::::::::::::::::::: ::::::::::: :: ::::::::::
ATCATGACTGTATTATACTGGCACATATCCCGAGCCAGTAAGAGCAGGATTAAGAAGGACAAGAAGGAGCCTGTGGCCAACCAAGAACCAGTTTCTCCAA
-I--M--T--V--L--Y--W--H--I--S--R--A--S--K--S--R--I--K--K--D--K--K--E--P--V--A--N--Q--E--P--V--S--P--

----------------------------------------------------------------------------------------------------
S--L--V--Q--G-----R--I--V--K--P--N--N--N--N--M--P--S--S--D--D--G--L--E--H--N--K--I--Q--N--G--K--A--P
GTCTGGTACAAGGA---AGGATAGTGAAGCCAAACAATAACAACATGCCCAGCAGTGACGATGGCCTGGAGCACAACAAAATCCAGAATGGCAAAGCCCC
::.::::::::::.   ::.:::::::::::.:::::.::.::.:::::..:::::::.:: : :::::::::::::::::::::::::::::::::.::
GTTTGGTACAAGGGA--AGAATAGTGAAGCCGAACAACAATAATATGCCTGGCAGTGATGAAGCCCTGGAGCACAACAAAATCCAGAATGGCAAAGCTCC
S--L--V--Q--G--\--R--I--V--K--P--N--N--N--N--M--P--G--S--D--E--A--L--E--H--N--K--I--Q--N--G--K--A--P

----------------------------------------------------------------------------------------------------
--R--D--P--V--T--E--N--C--V--Q--G--E--E--K--E--S--S--N--D--S--T--S--V--S--A--V--A--S--N--M--R--D--D-
CAGGGATCCTGTGACTGAAAACTGTGTTCAGGGAGAGGAGAAGGAGAGCTCCAATGACTCCACCTCAGTCAGTGCTGTTGCCTCTAATATGAGAGATGAT
::::::: ::::::::::.::::::::.::::::::::::::.::.::::::::.::.::::::::::::::::::::::::::::::::::::::::::
CAGGGATGCTGTGACTGAGAACTGTGTCCAGGGAGAGGAGAAAGAAAGCTCCAACGATTCCACCTCAGTCAGTGCTGTTGCCTCTAATATGAGAGATGAT
--R--D--A--V--T--E--N--C--V--Q--G--E--E--K--E--S--S--N--D--S--T--S--V--S--A--V--A--S--N--M--R--D--D-

----------------------------------------------------------------------------------------------------
-E--I--T--Q--D--E--N--T--V--S--T--S--L--G--H--S--K--D--E--N--S--K--Q--T--C--I--R--I--G--T--K--T--P--
GAAATAACCCAGGATGAAAACACAGTTTCCACTTCCCTGGGCCATTCCAAAGATGAGAACTCTAAGCAAACATGCATCAGAATTGGCACCAAGACCCCAA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::.::::: ::::::::::: ::
GAAATAACCCAGGATGAAAACACAGTTTCCACTTCCCTGGGCCATTCCAAAGATGAGAACTCAAAGCAAACATGCATCAAAATTGTCACCAAGACCCAAA
-E--I--T--Q--D--E--N--T--V--S--T--S--L--G--H--S--K--D--E--N--S--K--Q--T--C--I--K--I--V--T--K--T--Q--

----------------------------------------------------------------------------------------------------
K--S--D--S--C--T--P--T--N--T--T--V--E--V--V--G--S--S--G--Q--N--G--D--E--K--Q--N--I--V--A--R--K--I--V
AAAGTGACTCATGTACCCCAACTAATACCACCGTGGAGGTAGTGGGGTCTTCAGGTCAGAATGGAGATGAAAAGCAGAATATTGTAGCCCGCAAGATTGT
:::::::::::::.::::::.::::::::::.:::::: : :: :: ::::::::::::::::::::::::::.:::::.::::: ::.:::::::::::
AAAGTGACTCATGCACCCCAGCTAATACCACTGTGGAGCTTGTTGGTTCTTCAGGTCAGAATGGAGATGAAAAACAGAACATTGTCGCTCGCAAGATTGT
K--S--D--S--C--T--P--A--N--T--T--V--E--L--V--G--S--S--G--Q--N--G--D--E--K--Q--N--I--V--A--R--K--I--V

----------------------------------------------------------------------------------------------------
--K--M--T--K--Q--P--A--K--K--K--P--P--P--S--R--E--K--K--V--T--R--T--I--L--A--I--L--L--A--F--I--I--T-
GAAGATGACTAAGCAGCCTGCAAAAAAGAAGCCTCCTCCTTCCCGGGAAAAGAAAGTCACCAGGACAATCTTGGCTATTCTGTTGGCTTTCATCATCACT
:::::::::.::::::::::::::::::::::: ::::::::::::::::::::::: ::::::::.:::::::::::::::::::::::::::::::::
GAAGATGACCAAGCAGCCTGCAAAAAAGAAGCCGCCTCCTTCCCGGGAAAAGAAAGTGACCAGGACGATCTTGGCTATTCTGTTGGCTTTCATCATCACT
--K--M--T--K--Q--P--A--K--K--K--P--P--P--S--R--E--K--K--V--T--R--T--I--L--A--I--L--L--A--F--I--I--T-

----------------------------------------------------------------------------------------------------
-W--A--P--Y--N--V--M--V--L--I--N--T--F--C--A--P--C--I--P--N--T--V--W--T--I--G--Y--W--L--C--Y--I--N--
TGGGCCCCATACAATGTCATGGTGCTCATTAACACCTTTTGTGCACCTTGCATCCCCAACACTGTGTGGACAATTGGTTACTGGCTTTGTTACATCAACA
::::::::.:::::.:::::::::::::::::.:::::.::::::::.:::::::::::::: :::::::::::::::::.:::::.:::::::::::::
TGGGCCCCGTACAACGTCATGGTGCTCATTAATACCTTCTGTGCACCCTGCATCCCCAACACAGTGTGGACAATTGGTTATTGGCTCTGTTACATCAACA
-W--A--P--Y--N--V--M--V--L--I--N--T--F--C--A--P--C--I--P--N--T--V--W--T--I--G--Y--W--L--C--Y--I--N--

----------------------------------------------------------------------------------------------------
S--T--I--N--P--A--C--Y--A--L--C--N--A--T--F--K--K--T--F--K--H--L--L--M--C--H--Y--K--N--I--G--A--T--R
GCACTATCAACCCTGCCTGCTATGCACTTTGCAATGCCACCTTCAAGAAGACCTTTAAACACCTTCTCATGTGTCATTATAAGAACATAGGCGCTACAAG
:::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::
GCACTATCAACCCTGCCTGCTATGCACTTTGTAATGCCACCTTCAAGAAGACCTTTAAACACCTTCTTATGTGTCATTATAAGAACATAGGCGCTACAAG
S--T--I--N--P--A--C--Y--A--L--C--N--A--T--F--K--K--T--F--K--H--L--L--M--C--H--Y--K--N--I--G--A--T--R

----
--*-
GTAA
:   
G---
----

Pig Consensus Sequence

>BGISUST0000893821
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------ATTGCAGCCTTCTATTTGCCTGTgaTC
ATGACTGTATTATACTGGCACATATCCCGAGCCAGTAAGAGCAGGATTAAGAAGGACAAGAAGGAGCCTGTGGCCAACCAAGAACCAGTTTCTCCAAGTT
TGGTACAAGGgaGAATAGTGAAGCCGAACAACAATAATATGCCTGGCAGTGATGAAGCCCTGGAGCACAACAAAATCCAGAATGGCAAAGCTCCCAGGGA
TGCTGTGACTGAGAACTGTGTCCAGGGAGAGGAGAAAGAAAGCTCCAACGATTCCACCTCAGTCAGTGCTGTTGCCTCTAATATGAGAGATGATGAAATA
ACCCAGGATGAAAACACAGTTTCCACTTCCCTGGGCCATTCCAAAGATGAGAACTCAAAGCAAACATGCATCAAAATTGTCACCAAGACCCAAAAAAGTG
ACTCATGCACCCCAGCTAATACCACTGTGGAGCTTGTTGGTTCTTCAGGTCAGAATGGAGATGAAAAACAGAACATTGTCGCTCGCAAGATTGTGAAGAT
GACCAAGCAGCCTGCAAAAAAGAAGCCGCCTCCTTCCCGGGAAAAGAAAGTGACCAGGACGATCTTGGCTATTCTGTTGGCTTTCATCATCACTTGGGCC
CCGTACAACGTCATGGTGCTCATTAATACCTTCTGTGCACCCTGCATCCCCAACACAGTGTGGACAATTGGTTATTGGCTCTGTTACATCAACAGCACTA
TCAACCCTGCCTGCTATGCACTTTGTAATGCCACCTTCAAGAAGACCTTTAAACACCTTCTTATGTGTCATTATAAGAACATAGGCGCTACAAGG


>BGISUSP0000893821
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------------IAAFYLPVI
MTVLYWHISRASKSRIKKDKKEPVANQEPVSPSLVQGRIVKPNNNNMPGSDEALEHNKIQNGKAPRDAVTENCVQGEEKESSNDSTSVSAVASNMRDDEI
TQDENTVSTSLGHSKDENSKQTCIKIVTKTQKSDSCTPANTTVELVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWA
PYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR