Sequences
EST Library Info
pliv1Unavailable
plun3Unavailable
uio1Unavailable
ute3Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000005436 (click for geneview)
Transcript ID ENST00000321027(link to ensembl)
Symbol NP_003194.3
Localtion Chromosome:2:75800949:75849977:-1 band: 2p12
Description chromosome 2 open reading frame 3
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--H--R--P--K--R--T--F--R--Q--R--A--A--D--S--S--D--S--D--G--A--E--E--S--P--A--E--P--G--A--P--R--
ATGGCTCACAGGCCGAAAAGGACTTTTCGGCAGCGCGCGGCTGATTCCAGCGACAGCGATGGCGCCGAGGAGTCGCCTGCTGAGCCTGGGGCGCCGAGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
E--L--P--V--P--G--S--A--E--E--E--P--P--S--G--G--G--R--A--Q--V--A--G--L--P--H--R--V--R--G--P--R--G--R
AACTTCCGGTCCCGGGTTCTGCGGAGGAAGAGCCGCCCTCTGGAGGAGGCCGCGCGCAGGTGGCGGGACTGCCCCACCGGGTTCGGGGCCCTCGTGGCCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------><----------------------------------
--G--R--V--W--A--S--S--R--R--A--T--K--A--A--P--R--A--D--E--G--S--E--S--R--T--L--D--V--S--T--D--E--E-
GGGCCGGGTCTGGGCGAGCTCCCGGCGTGCCACCAAAGCGGCTCCCCGCGCGGACGAAGGCTCAGAATCCAGAACCCTTGATGTGTCCACAGATGAAGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------------><-----
-D--K--I--H--H--S--S--E--S--K--D--D--Q--G--L--S--S--D--S--S--S--S--L--G--E--K--E--L--S--S--T--V--K--
GATAAAATACATCACTCCTCAGAAAGTAAGGATGATCAGGGTTTGTCTTCTGACAGTTCTAGCTCTCTTGGAGAAAAAGAACTTTCATCAACAGTTAAGA
                                                                                                :: .
------------------------------------------------------------------------------------------------AATG
-------------------------------------------------------------------------------------------------N--

----------------------------------------------------------------------------------------------------
I--P--D--A--A--F--I--Q--A--A--R--R--K--R--E--L--A--R--A--Q--D--D--Y--I--S--L--D--V--Q--H--T--S--S--I
TCCCAGATGCAGCTTTTATTCAGGCAGCCCGCAGAAAACGTGAATTGGCCAGGGCCCAAGATGACTATATTTCTTTGGATGTACAACATACCTCCTCCAT
:::: ::::::::::::::::::::.:::..:::.:::::::::::::::::::::::.:: ::::::::::::::::::::: :::::..::::  :::
TCCCTGATGCAGCTTTTATTCAGGCGGCCTACAGGAAACGTGAATTGGCCAGGGCCCAGGAGGACTATATTTCTTTGGATGTAAAACATGTCTCCAACAT
V--P--D--A--A--F--I--Q--A--A--Y--R--K--R--E--L--A--R--A--Q--E--D--Y--I--S--L--D--V--K--H--V--S--N--I

----------------------------------------------------------------------------------------------------
--S--G--M--K--R--E--S--E--D--D--P--E--S--E--P--D--D--H--E--K--R--I--P--F--T--L--R--P--Q--T--L--R--Q-
CTCTGGTATGAAGAGAGAGAGCGAAGATGACCCTGAGAGTGAGCCTGATGACCATGAAAAGAGAATACCATTTACTCTAAGACCTCAAACACTTAGACAA
::::..::::::::.:.: ::.::::.:  :   ::.::::::::::::::.:::::::: : ::::::::::::.:..:..:::::::: :::::::::
CTCTAATATGAAGAAAAACAGTGAAGGTTCC---GAAAGTGAGCCTGATGATCATGAAAATATAATACCATTTACCCCGAAGCCTCAAACTCTTAGACAA
--S--N--M--K--K--N--S--E--G--S-----E--S--E--P--D--D--H--E--N--I--I--P--F--T--P--K--P--Q--T--L--R--Q-

------------------><--------------------------------------------------------------------------------
-R--M--A--E--E--S--I--S--R--N--E--E--T--S--E--E--S--Q--E--D--E--K--Q--D--T--W--E--Q--Q--Q--M--R--K--
AGGATGGCTGAGGAATCAATAAGCAGAAATGAAGAAACAAGTGAAGAAAGTCAGGAAGATGAAAAGCAAGATACTTGGGAACAACAGCAAATGAGGAAAG
::.::::::::.::: ::                                                                                  
AGAATGGCTGAAGAAACA----------------------------------------------------------------------------------
-R--M--A--E--E--T-----------------------------------------------------------------------------------

----------------><----------------------------------------------------------------------------------
A--V--K--I--I--E--E--R--D--I--D--L--S--C--G--N--G--S--S--K--V--K--K--F--D--T--S--I--S--F--P--P--V--N
CAGTTAAAATCATAGAGGAAAGAGACATAGATCTTTCCTGTGGCAATGGATCTTCAAAAGTGAAGAAATTTGATACTTCCATTTCATTTCCGCCAGTAAA
                     ::::::::::::: ::.:.:.:::.::.::::. :: :::::::::.::::::..:::.:::::::::::.:::.::::
--------------------CGAGACATAGATCTGTCTTATAGCAGTGAATCTCAAACAGTGAAGAAGTTTGATGTTTCTATTTCATTTCCACCAATAAA
---------------------R--D--I--D--L--S--Y--S--S--E--S--Q--T--V--K--K--F--D--V--S--I--S--F--P--P--I--N

--------------------------------><------------------------------------------------------------------
--L--E--I--I--K--K--Q--L--N--T--R--L--T--L--L--Q--E--T--H--R--S--H--L--R--E--Y--E--K--Y--V--Q--D--V-
TTTAGAAATTATAAAGAAGCAATTAAATACTAGATTAACATTACTACAGGAAACTCACCGCTCACACCTGAGGGAGTATGAAAAATACGTACAAGATGTC
::::::::::::::::::::::.:::::      :::::::::::.::::: ::::::::.:::::::: ::.::.::.:::::::::::. :::::.::
TTTAGAAATTATAAAGAAGCAACTAAAT------TTAACATTACTGCAGGATACTCACCGTTCACACCTCAGAGAATACGAAAAATACGTGGAAGATATC
--L--E--I--I--K--K--Q--L--N--------L--T--L--L--Q--D--T--H--R--S--H--L--R--E--Y--E--K--Y--V--E--D--I-

----------------------------------------------------------------------------------------------------
-K--S--S--K--S--T--I--Q--N--L--E--S--S--S--N--Q--A--L--N--C--K--F--Y--K--S--M--K--I--Y--V--E--N--L--
AAAAGCTCAAAGAGTACCATCCAGAACCTAGAGAGTTCATCAAATCAAGCTCTAAATTGTAAATTCTATAAAAGCATGAAAATTTATGTGGAAAATTTAA
::.: :::::::::::::::::::::::::::::.::::::::.:::::::::::::: ::::::::::::::::::::::::::::::::::::.::::
AAGACCTCAAAGAGTACCATCCAGAACCTAGAGAATTCATCAAGTCAAGCTCTAAATTTTAAATTCTATAAAAGCATGAAAATTTATGTGGAAAACTTAA
-K--T--S--K--S--T--I--Q--N--L--E--N--S--S--S--Q--A--L--N--F--K--F--Y--K--S--M--K--I--Y--V--E--N--L--

-------------------><-------------------------------------------------------------------------------
I--D--C--L--N--E--K--I--I--N--I--Q--E--I--E--S--S--M--H--A--L--L--L--K--Q--A--M--T--F--M--K--R--R--Q
TTGACTGCCTTAATGAAAAGATTATCAACATCCAAGAAATAGAATCATCCATGCATGCACTCCTTTTAAAACAAGCTATGACCTTTATGAAACGCAGGCA
:::::::.:::::::::::::::::::.::::::::::::::::::: :::::::::::::.::::::::::::::.::::.::::::::::::::::::
TTGACTGTCTTAATGAAAAGATTATCAGCATCCAAGAAATAGAATCAGCCATGCATGCACTTCTTTTAAAACAAGCCATGATCTTTATGAAACGCAGGCA
I--D--C--L--N--E--K--I--I--S--I--Q--E--I--E--S--A--M--H--A--L--L--L--K--Q--A--M--I--F--M--K--R--R--Q

-------------------------------------------><-------------------------------------------------------
--D--E--L--K--H--E--S--T--Y--L--Q--Q--L--S--R--K--D--E--T--S--T--S--G--N--F--S--V--D--E--K--T--Q--W-
AGATGAATTAAAACATGAATCAACGTATTTACAACAGTTATCACGCAAAGATGAGACATCCACAAGTGGAAACTTCTCAGTAGATGAAAAAACTCAGTGG
:::::::.::::::::::: ::::::::::::::::.::::::   ::.: ::::.:::: ::::.:.::..:::    :::::::::::::::::.:::
AGATGAACTAAAACATGAAGCAACGTATTTACAACAATTATCA---AAGGCTGAGGCATCAACAAATAGAGGCTTGGATGTAGATGAAAAAACTCAATGG
--D--E--L--K--H--E--A--T--Y--L--Q--Q--L--S-----K--A--E--A--S--T--N--R--G--L--D--V--D--E--K--T--Q--W-

-------------------------><-------------------------------------------------------------------------
-I--L--E--E--I--E--S--R--R--T--K--R--R--Q--A--R--V--L--S--G--N--C--N--H--Q--E--G--T--S--S--D--D--E--
ATTTTAGAAGAGATTGAATCTCGAAGGACAAAAAGAAGACAAGCAAGGGTGCTTTCTGGGAATTGTAACCATCAGGAAGGAACATCTAGTGATGATGAAC
::::: ::.:::::::::::::::   .:: ::::::::::::::::::. :::::::::::::::: .::.::::::::.:..::::::::::::::::
ATTTTTGAGGAGATTGAATCTCGA---GCACAAAGAAGACAAGCAAGGGCTCTTTCTGGGAATTGTACTCACCAGGAAGGGATGTCTAGTGATGATGAAC
-I--F--E--E--I--E--S--R-----A--Q--R--R--Q--A--R--A--L--S--G--N--C--T--H--Q--E--G--M--S--S--D--D--E--

--------------------------------------><------------------------------------------------------------
L--P--S--A--E--M--I--D--F--Q--K--S--Q--G--D--I--L--Q--K--Q--K--K--V--F--E--E--V--Q--D--D--F--C--N--I
TGCCTTCAGCAGAGATGATTGACTTCCAAAAAAGCCAAGGTGACATTTTACAGAAACAGAAGAAAGTTTTTGAAGAAGTGCAAGATGATTTTTGTAACAT
::.:::::::::: :..:::::::::::.:::::::.:   :::::::::::::: :: :::::..:::::::::: ::::: ::::::::::::::.::
TGTCTTCAGCAGACACAATTGACTTCCAGAAAAGCCGA---GACATTTTACAGAATCATAAGAAGATTTTTGAAGATGTGCATGATGATTTTTGTAATAT
L--S--S--A--D--T--I--D--F--Q--K--S--R-----D--I--L--Q--N--H--K--K--I--F--E--D--V--H--D--D--F--C--N--I

----------------------------------------------------------------------------------------------------
--Q--N--I--L--L--K--F--Q--Q--W--R--E--K--F--P--D--S--Y--Y--E--A--F--I--S--L--C--I--P--K--L--L--N--P-
CCAGAATATTTTGTTGAAATTTCAGCAATGGCGAGAAAAGTTTCCTGACTCCTATTATGAAGCTTTCATTAGTTTATGCATACCAAAGCTTTTAAATCCC
::::::::::::.:::::::::::.:::::::::::::::::::::::.::.::::::::::::::::::::::::::::: ::.:::::::::::::::
CCAGAATATTTTATTGAAATTTCAACAATGGCGAGAAAAGTTTCCTGATTCTTATTATGAAGCTTTCATTAGTTTATGCATTCCGAAGCTTTTAAATCCC
--Q--N--I--L--L--K--F--Q--Q--W--R--E--K--F--P--D--S--Y--Y--E--A--F--I--S--L--C--I--P--K--L--L--N--P-

--------------------------------------><------------------------------------------------------------
-L--I--R--V--Q--L--I--D--W--N--P--L--K--L--E--S--T--G--L--K--E--M--P--W--F--K--S--V--E--E--F--M--D--
CTAATACGAGTTCAGTTGATTGATTGGAATCCTCTTAAGTTGGAATCCACAGGTTTAAAAGAGATGCCATGGTTCAAATCTGTAGAAGAATTTATGGATA
::::::::: :::::.::::::::::::::::::::::::: :: ::::.:::::::::: :::::::.::::::: :::..::.::::::::::.::::
CTAATACGATTTCAGCTGATTGATTGGAATCCTCTTAAGTTTGATTCCATAGGTTTAAAACAGATGCCGTGGTTCACATCCATAAAAGAATTTATAGATA
-L--I--R--F--Q--L--I--D--W--N--P--L--K--F--D--S--I--G--L--K--Q--M--P--W--F--T--S--I--K--E--F--I--D--

-----------------------------------------------------------------------------------------><---------
S--S--V--E--D--S--K--K--E--S--S--S--D--K--K--V--L--S--A--I--I--N--K--T--I--I--P--R--L--T--D--F--V--E
GCAGTGTGGAAGATTCAAAGAAGGAAAGTAGTTCAGATAAAAAAGTCTTGTCTGCAATCATCAACAAAACAATTATTCCCCGACTTACAGACTTTGTAGA
:::::.:::::::::::::::::.:::.:::::: :::::.:::.:.:::::::: .:.:::::::::.::.:::::::.:::::: ::   ::::::::
GCAGTATGGAAGATTCAAAGAAGAAAAATAGTTCTGATAAGAAAATTTTGTCTGCTGTTATCAACAAAGCAGTTATTCCTCGACTTTCA---TTTGTAGA
S--S--M--E--D--S--K--K--K--N--S--S--D--K--K--I--L--S--A--V--I--N--K--A--V--I--P--R--L--S-----F--V--E

----------------------------------------------------------------------------------------------------
--F--L--W--D--P--L--S--T--S--Q--T--T--S--L--I--T--H--C--R--V--I--L--E--E--H--S--T--C--E--N--E--V--S-
ATTCCTTTGGGATCCTTTGTCAACCTCACAGACAACAAGTTTAATAACACATTGCAGAGTGATTCTTGAAGAACATTCCACTTGTGAAAATGAAGTTAGT
:::: ::::::::::.::::::::::::::::::::::::::::::: .:: ::::.:.:::::::::::::::::::::::::::::::::::: ::::
ATTCGTTTGGGATCCCTTGTCAACCTCACAGACAACAAGTTTAATAAGGCAGTGCAAAATGATTCTTGAAGAACATTCCACTTGTGAAAATGAAGATAGT
--F--V--W--D--P--L--S--T--S--Q--T--T--S--L--I--R--Q--C--K--M--I--L--E--E--H--S--T--C--E--N--E--D--S-

-----------><---------------------------------------------------------------------------><----------
-K--S--R--Q--D--L--L--K--S--I--V--S--R--M--K--K--A--V--E--D--D--V--F--I--P--L--Y--P--K--S--A--V--E--
AAAAGCAGACAGGATTTACTTAAATCCATTGTTTCAAGAATGAAAAAGGCAGTAGAAGATGATGTTTTTATTCCTCTGTATCCAAAGAGTGCTGTAGAAA
:::.:::.::::::::::::::::. ::::::::.:::::::::.::::::.::::::::::::::::::::::::::::::::      :::..:::.:
AAAGGCAAACAGGATTTACTTAAACGCATTGTTTTAAGAATGAAGAAGGCAATAGAAGATGATGTTTTTATTCCTCTGTATCCA------GCTACAGAGA
-K--G--K--Q--D--L--L--K--R--I--V--L--R--M--K--K--A--I--E--D--D--V--F--I--P--L--Y--P--------A--T--E--

-------------------------------------------------------><-------------------------------------------
N--K--T--S--P--H--S--K--F--Q--E--R--Q--F--W--S--G--L--K--L--F--R--N--I--L--L--W--N--G--L--L--T--D--D
ACAAAACATCACCTCATTCAAAGTTCCAAGAAAGACAGTTCTGGTCAGGCCTAAAGCTCTTCCGCAATATTCTTCTTTGGAATGGACTCCTTACAGATGA
:::.::::::::: ::: :::::::::::::::::::::::::::::::.:::::::::::::.::::::::::::::::::::::::: :. :::: ::
ACAGAACATCACCACATGCAAAGTTCCAAGAAAGACAGTTCTGGTCAGGTCTAAAGCTCTTCCACAATATTCTTCTTTGGAATGGACTCATCCCAGAAGA
N--R--T--S--P--H--A--K--F--Q--E--R--Q--F--W--S--G--L--K--L--F--H--N--I--L--L--W--N--G--L--I--P--E--D

----------------------------------------------------------------------------------------------------
--T--L--Q--E--L--G--L--G--K--L--L--N--R--Y--L--I--I--A--L--L--N--A--T--P--G--P--D--V--V--K--K--C--N-
CACCTTGCAAGAACTAGGACTAGGGAAGCTGCTAAATCGTTACCTTATTATAGCACTTCTCAATGCCACACCTGGGCCAGATGTGGTTAAAAAGTGCAAC
::::::::::::.:::::::::::::::::::::::.::::::::::::.::::    ::.:::::::.::::::::::::::: :::::::::::::::
CACCTTGCAAGAGCTAGGACTAGGGAAGCTGCTAAACCGTTACCTTATTGTAGCT---CTTAATGCCATACCTGGGCCAGATGTTGTTAAAAAGTGCAAC
--T--L--Q--E--L--G--L--G--K--L--L--N--R--Y--L--I--V--A-----L--N--A--I--P--G--P--D--V--V--K--K--C--N-

--><------------------------------------------------------------------------------------------------
-Q--V--A--A--C--L--P--E--K--W--F--E--N--S--A--M--R--T--S--I--P--Q--L--E--N--F--I--Q--F--L--L--Q--S--
CAGGTAGCAGCATGTCTACCAGAAAAATGGTTTGAAAATTCTGCCATGAGGACATCTATTCCACAGCTAGAAAACTTCATTCAGTTTTTATTGCAGTCTG
      :::::::.:.::::::::.:::::::. :::::::::: :::::.::::::::::: :::::::::::::::::.:::::::::.:::::::::
------GCAGCATATTTACCAGAAGAATGGTTCCAAAATTCTGCGATGAGAACATCTATTCCCCAGCTAGAAAACTTCATCCAGTTTTTACTGCAGTCTG
-------A--A--Y--L--P--E--E--W--F--Q--N--S--A--M--R--T--S--I--P--Q--L--E--N--F--I--Q--F--L--L--Q--S--

---------------------------><-----------------------------------------------------------------------
A--H--K--L--S--R--S--E--F--R--D--E--V--E--E--I--I--L--I--L--V--K--I--K--A--L--N--Q--A--E--S--F--I--G
CACATAAATTATCTAGAAGTGAATTCAGGGATGAAGTCGAAGAAATAATTCTTATTTTGGTGAAAATAAAAGCTTTGAATCAAGCAGAATCCTTCATAGG
:::::::::::::::::::::::      ::::::.::.::::::::::. :::::.:::::::::::::.:::.:.: :::::::::::::::. :::.
CACATAAATTATCTAGAAGTGAA------GATGAAATCAAAGAAATAATCATTATTCTGGTGAAAATAAAGGCTCTAACTCAAGCAGAATCCTTTTTAGA
A--H--K--L--S--R--S--E--------D--E--I--K--E--I--I--I--I--L--V--K--I--K--A--L--T--Q--A--E--S--F--L--E

--------------------------------------------->
--E--H--H--L--D--H--L--K--S--L--I--K--E--D--*-
AGAGCATCACCTAGACCATCTTAAATCACTAATTAAAGAAGATTGA
::::.::::::::::::::::::::::: :::::::::::: ::::
AGAGTATCACCTAGACCATCTTAAATCAGTAATTAAAGAAGTTTGA
--E--Y--H--L--D--H--L--K--S--V--I--K--E--V--*-

Pig Consensus Sequence

>BGISUST0000894233
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------AATG
TCCCTGATGCAGCTTTTATTCAGGCGGCCTACAGGAAACGTGAATTGGCCAGGGCCCAGGAGGACTATATTTCTTTGGATGTAAAACATGTCTCCAACAT
CTCTAATATGAAGAAAAACAGTGAAGGTTCCGAAAGTGAGCCTGATGATCATGAAAATATAATACCATTTACCCCGAAGCCTCAAACTCTTAGACAAAGA
ATGGCTGAAGAAACA-------------------------------------------------------------------------------------
-----------------CGAGACATAGATCTGTCTTATAGCAGTGAATCTCAAACAGTGAAGAAGTTTGATGTTTCTATTTCATTTCCACCAATAAATTT
AGAAATTATAAAGAAGCAACTAAAT------TTAACATTACTGCAGGATACTCACCGTTCACACCTCAGAGAATACGAAAAATACGTGGAAGATATCAAG
ACCTCAAAGAGTACCATCCAGAACCTAGAGAATTCATCAAGTCAAGCTCTAAATTTTAAATTCTATAAAAGCATGAAAATTTATGTGGAAAACTTAATTG
ACTGTCTTAATGAAAAGATTATCAGCATCCAAGAAATAGAATCAGCCATGCATGCACTTCTTTTAAAACAAGCCATGATCTTTATGAAACGCAGGCAAGA
TGAACTAAAACATGAAGCAACGTATTTACAACAATTATCA---AAGGCTGAGGCATCAACAAATAGAGGCTTGGATGTAGATGAAAAAACTCAATGGATT
TTTGAGGAGATTGAATCTCGA---GCACAAAGAAGACAAGCAAGGGCTCTTTCTGGGAATTGTACTCACCAGGAAGGGATGTCTAGTGATGATGAACTGT
CTTCAGCAGACACAATTGACTTCCAGAAAAGCCGA---GACATTTTACAGAATCATAAGAAGATTTTTGAAGATGTGCATGATGATTTTTGTAATATCCA
GAATATTTTATTGAAATTTCAACAATGGCGAGAAAAGTTTCCTGATTCTTATTATGAAGCTTTCATTAGTTTATGCATTCCGAAGCTTTTAAATCCCCTA
ATACGATTTCAGCTGATTGATTGGAATCCTCTTAAGTTTGATTCCATAGGTTTAAAACAGATGCCGTGGTTCACATCCATAAAAGAATTTATAGATAGCA
GTATGGAAGATTCAAAGAAGAAAAATAGTTCTGATAAGAAAATTTTGTCTGCTGTTATCAACAAAGCAGTTATTCCTCGACTTTCA---TTTGTAGAATT
CGTTTGGGATCCCTTGTCAACCTCACAGACAACAAGTTTAATAAGGCAGTGCAAAATGATTCTTGAAGAACATTCCACTTGTGAAAATGAAGATAGTAAA
GGCAAACAGGATTTACTTAAACGCATTGTTTTAAGAATGAAGAAGGCAATAGAAGATGATGTTTTTATTCCTCTGTATCCA------GCTACAGAGAACA
GAACATCACCACATGCAAAGTTCCAAGAAAGACAGTTCTGGTCAGGTCTAAAGCTCTTCCACAATATTCTTCTTTGGAATGGACTCATCCCAGAAGACAC
CTTGCAAGAGCTAGGACTAGGGAAGCTGCTAAACCGTTACCTTATTGTAGCTCTTAATGCCATACCTGGGCCAGATGTTGTTAAAAAGTGCAAC------
GCAGCATATTTACCAGAAGAATGGTTCCAAAATTCTGCGATGAGAACATCTATTCCCCAGCTAGAAAACTTCATCCAGTTTTTACTGCAGTCTGCACATA
AATTATCTAGAAGTGAA------GATGAAATCAAAGAAATAATCATTATTCTGGTGAAAATAAAGGCTCTAACTCAAGCAGAATCCTTTTTAGAAGAGTA
TCACCTAGACCATCTTAAATCAGTAATTAAAGAAGTTTGA


>BGISUSP0000894233
----------------------------------------------------------------------------------------------------
--------------------------------NVPDAAFIQAAYRKRELARAQEDYISLDVKHVSNISNMKKNSEGSESEPDDHENIIPFTPKPQTLRQR
MAEET----------------------------------RDIDLSYSSESQTVKKFDVSISFPPINLEIIKKQLN--LTLLQDTHRSHLREYEKYVEDIK
TSKSTIQNLENSSSQALNFKFYKSMKIYVENLIDCLNEKIISIQEIESAMHALLLKQAMIFMKRRQDELKHEATYLQQLS-KAEASTNRGLDVDEKTQWI
FEEIESR-AQRRQARALSGNCTHQEGMSSDDELSSADTIDFQKSR-DILQNHKKIFEDVHDDFCNIQNILLKFQQWREKFPDSYYEAFISLCIPKLLNPL
IRFQLIDWNPLKFDSIGLKQMPWFTSIKEFIDSSMEDSKKKNSSDKKILSAVINKAVIPRLS-FVEFVWDPLSTSQTTSLIRQCKMILEEHSTCENEDSK
GKQDLLKRIVLRMKKAIEDDVFIPLYP--ATENRTSPHAKFQERQFWSGLKLFHNILLWNGLIPEDTLQELGLGKLLNRYLIVALNAIPGPDVVKKCN--
AAYLPEEWFQNSAMRTSIPQLENFIQFLLQSAHKLSRSE--DEIKEIIIILVKIKALTQAESFLEEYHLDHLKSVIKEV*