Sequences
EST Library Info
jej2Small intestine, jejunum
lin1Large intestine
nlu1Newborn 115 days, lung
sin2Small intestine
ste2M. Semitendinosus
Clusters
Oligos
SNPs

Gene ID ENSG00000181061 (click for geneview)
Transcript ID ENST00000321331(link to ensembl)
Symbol NP_054775.1
Localtion Chromosome:3:42800799:42820997:-1 band: 3p22.1
Description DKFZP564K247 protein
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------------------------------------------------><--
-M--S--T--D--T--G--V--S--L--P--S--Y--E--E--D--Q--G--S--K--L--I--R--K--A--K--E--A--P--F--V--P--V--G--
ATGTCAACAGACACAGGTGTTTCCCTTCCTTCATATGAGGAAGATCAGGGATCAAAACTCATTCGAAAAGCTAAAGAGGCACCATTCGTACCCGTTGGAA
:::::::: :::::::.::: ::.:::.:::::::::: ::.::::::::::: :::::.::.:::::::: ::::::::::::::.:: :::.::   :
ATGTCAACTGACACAGATGTGTCTCTTTCTTCATATGATGAGGATCAGGGATCTAAACTTATCCGAAAAGCAAAAGAGGCACCATTTGTCCCCATT---A
-M--S--T--D--T--D--V--S--L--S--S--Y--D--E--D--Q--G--S--K--L--I--R--K--A--K--E--A--P--F--V--P--I-----

----------------------------------------------------------------------------------------------------
I--A--G--F--A--A--I--V--A--Y--G--L--Y--K--L--K--S--R--G--N--T--K--M--S--I--H--L--I--H--M--R--V--A--A
TAGCGGGTTTTGCAGCAATTGTTGCATATGGATTATATAAACTGAAGAGCAGGGGAAATACTAAAATGTCCATTCATCTGATCCACATGCGTGTGGCAGC
:.::.:::::::: :::::.:::::::::::::::::::::.::::::::::.:::::::::::::::::..::::::::::::::::::::::::::::
TGGCAGGTTTTGCTGCAATCGTTGCATATGGATTATATAAATTGAAGAGCAGAGGAAATACTAAAATGTCTGTTCATCTGATCCACATGCGTGTGGCAGC
M--A--G--F--A--A--I--V--A--Y--G--L--Y--K--L--K--S--R--G--N--T--K--M--S--V--H--L--I--H--M--R--V--A--A

-------------------------------><------------------------------------------------>
--Q--G--F--V--V--G--A--M--T--V--G--M--G--Y--S--M--Y--R--E--F--W--A--K--P--K--P--*-
CCAAGGCTTTGTTGTAGGAGCAATGACTGTTGGTATGGGCTATTCCATGTATCGGGAATTCTGGGCAAAACCTAAGCCTTAG
:::::::::::::::.:::::::::::: ::   :::::.::.:::::::::::.::::::::::::::::::::.::::::
CCAAGGCTTTGTTGTGGGAGCAATGACTCTT---ATGGGTTACTCCATGTATCGAGAATTCTGGGCAAAACCTAAACCTTAG
--Q--G--F--V--V--G--A--M--T--L-----M--G--Y--S--M--Y--R--E--F--W--A--K--P--K--P--*-

Pig Consensus Sequence

>BGISUST0000885462
ATGTCAACTGACACAGATGTGTCTCTTTCTTCATATGATGAGGATCAGGGATCTAAACTTATCCGAAAAGCAAAAGAGGCACCATTTGTCCCCATT---A
TGGCAGGTTTTGCTGCAATCGTTGCATATGGATTATATAAATTGAAGAGCAGAGGAAATACTAAAATGTCTGTTCATCTGATCCACATGCGTGTGGCAGC
CCAAGGCTTTGTTGTGGGAGCAATGACTCTT---ATGGGTTACTCCATGTATCGAGAATTCTGGGCAAAACCTAAACCTTAG


>BGISUSP0000885462
MSTDTDVSLSSYDEDQGSKLIRKAKEAPFVPI-MAGFAAIVAYGLYKLKSRGNTKMSVHLIHMRVAAQGFVVGAMTL-MGYSMYREFWAKPKP*