Sequences
EST Library Info
tes2Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000177294 (click for geneview)
Transcript ID ENST00000321535(link to ensembl)
Symbol FBXO39
Localtion Chromosome:17:6620296:6631688:1 band: 17p13.1
Description F-box only protein 39. [Source:Uniprot/SWISSPROT;Acc:Q8N4B4]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--E--E--S--E--L--I--Q--P--Q--D--Q--S--C--W--A--F--L--P--D--L--C--L--C--R--V--F--W--W--L--G--D--
ATGGACGAAGAAAGTGAACTGATCCAGCCCCAAGACCAGAGCTGCTGGGCCTTTCTGCCCGATTTGTGTCTGTGCCGTGTTTTCTGGTGGCTAGGAGACA
::::::::::::.:. ::::: : :::::.::::::::::::::::::::: .::::::.::: ::::::::.:.:::::::::::::::::::::::::
ATGGACGAAGAAGGCCAACTGCTGCAGCCTCAAGACCAGAGCTGCTGGGCCACTCTGCCTGATGTGTGTCTGCGTCGTGTTTTCTGGTGGCTAGGAGACA
-M--D--E--E--G--Q--L--L--Q--P--Q--D--Q--S--C--W--A--T--L--P--D--V--C--L--R--R--V--F--W--W--L--G--D--

----------------------------------------------------------------------------------------------------
R--D--R--S--R--A--A--L--V--C--R--K--W--N--Q--M--M--Y--S--A--E--L--W--R--Y--R--T--I--T--F--S--G--R--P
GGGACAGGTCCAGGGCTGCTCTTGTCTGCAGAAAGTGGAACCAGATGATGTATTCTGCTGAGCTCTGGCGGTACAGAACCATCACCTTCAGCGGGAGACC
:::::::::::::::: ::.::.:::::::::::.:::::::::::.:::::::: ::::: ::::::::.:::::.:::::::: :::::.::.:::::
GGGACAGGTCCAGGGCGGCCCTCGTCTGCAGAAAATGGAACCAGATAATGTATTCAGCTGACCTCTGGCGATACAGGACCATCACGTTCAGTGGAAGACC
R--D--R--S--R--A--A--L--V--C--R--K--W--N--Q--I--M--Y--S--A--D--L--W--R--Y--R--T--I--T--F--S--G--R--P

----------------------------------------------------------------------------------------------------
--S--R--V--H--A--S--E--V--E--S--A--V--W--Y--V--K--K--F--G--R--Y--L--E--H--L--E--V--K--F--M--N--P--Y-
TTCCAGGGTACATGCATCTGAAGTTGAGTCAGCTGTTTGGTATGTTAAGAAGTTTGGTCGTTATCTGGAGCACCTGGAGGTCAAATTCATGAATCCTTAC
::::::::::::.::.:::::: :.:::::.::: ::::::::::.:::::.:::::::::::::::::::::::::::.:::::::: :::::::::::
TTCCAGGGTACACGCGTCTGAATTCGAGTCGGCTCTTTGGTATGTCAAGAAATTTGGTCGTTATCTGGAGCACCTGGAGATCAAATTCCTGAATCCTTAC
--S--R--V--H--A--S--E--F--E--S--A--L--W--Y--V--K--K--F--G--R--Y--L--E--H--L--E--I--K--F--L--N--P--Y-

----------------------------------------------------------------------------------------------------
-N--A--V--L--T--K--K--F--Q--V--T--M--R--G--L--L--S--C--L--S--K--S--N--N--R--L--K--S--L--S--I--Q--Y--
AATGCTGTCTTGACCAAGAAGTTCCAGGTCACCATGCGGGGCCTCCTGTCTTGTCTGAGTAAGAGCAACAACCGTCTGAAATCTCTTTCCATCCAATACC
:::::::::.::::::::::::::::::::::::::::.:::::.:: :: ::::::.:.:::::.::::::::::: :.:::::: ::::::::..:::
AATGCTGTCCTGACCAAGAAGTTCCAGGTCACCATGCGAGGCCTTCTCTCGTGTCTGGGCAAGAGTAACAACCGTCTCAGATCTCTGTCCATCCAGCACC
-N--A--V--L--T--K--K--F--Q--V--T--M--R--G--L--L--S--C--L--G--K--S--N--N--R--L--R--S--L--S--I--Q--H--

----------------------------------------------------------------------------------------------------
L--E--L--D--R--L--V--W--R--N--S--I--R--S--S--F--I--S--S--L--S--F--F--L--K--K--M--G--K--R--L--D--Y--L
TGGAGCTGGACCGCCTGGTATGGAGGAACAGCATCAGGAGCTCATTCATCAGCAGCTTGAGCTTCTTCTTAAAGAAGATGGGCAAACGCCTGGATTATCT
::::.:::::::::::::: ::::::::::::::: ::::::::::::: :. :::::::::::::::::.::..:.::::::::::.::::::::::::
TGGAACTGGACCGCCTGGTCTGGAGGAACAGCATCCGGAGCTCATTCATGAAAAGCTTGAGCTTCTTCTTGAAAGAAATGGGCAAACACCTGGATTATCT
L--E--L--D--R--L--V--W--R--N--S--I--R--S--S--F--M--K--S--L--S--F--F--L--K--E--M--G--K--H--L--D--Y--L

----------------------------------------------------------------------------------------------------
--N--L--K--G--A--R--L--T--V--E--Q--G--C--Q--I--L--D--S--L--S--Y--M--R--N--E--N--V--I--S--E--L--N--I-
CAACCTAAAAGGGGCCAGGCTGACCGTGGAGCAAGGCTGCCAAATTCTCGACTCCCTCAGCTACATGAGGAATGAGAATGTGATCTCAGAGCTCAACATC
::::::.::::::::::::                                                                                 
CAACCTGAAAGGGGCCAGG---------------------------------------------------------------------------------
--N--L--K--G--A--R----------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--D--Y--F--S--H--H--L--A--V--Y--N--S--P--Q--F--K--K--T--M--S--T--F--H--N--L--V--S--L--N--L--N--Y--
GAGGACTATTTCAGCCATCACCTTGCTGTCTACAACAGCCCCCAGTTCAAAAAGACCATGTCCACATTCCACAATCTTGTGTCCCTGAACCTCAACTACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--C--I--S--D--E--L--L--E--N--L--C--E--N--A--S--T--L--R--T--I--N--I--K--C--H--V--H--D--P--H--G--Q--V
ACTGTATCTCCGACGAGCTGCTTGAGAACTTGTGTGAGAATGCCAGCACCCTCCGGACCATCAACATCAAATGCCACGTTCATGACCCCCACGGACAGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--I--W--G--M--S--W--A--K--L--A--R--Q--A--T--N--L--K--V--N--F--F--F--E--R--I--M--K--Y--E--R--L--A--R-
CATCTGGGGTATGTCCTGGGCCAAGCTGGCCAGGCAGGCCACCAATCTGAAGGTGAACTTCTTCTTTGAACGGATCATGAAGTACGAACGCTTGGCCCGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--L--L--Q--E--I--P--I--R--S--I--S--L--R--S--C--Y--F--S--D--P--D--C--S--M--R--P--T--L--I--D--L--L--
ATCCTCTTGCAGGAGATCCCGATCAGGAGCATCAGTCTGAGAAGCTGCTATTTCAGTGACCCAGACTGTTCAATGAGACCCACTCTGATAGATCTCCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------><----------------------------------------------------------------------------
P--T--F--R--H--T--L--Q--K--L--T--C--E--F--N--N--N--H--E--S--L--D--E--E--L--H--L--L--I--I--S--C--R--K
CCACCTTCCGGCACACTCTGCAGAAATTAACTTGTGAATTCAACAACAACCATGAGTCACTCGACGAGGAGCTGCACCTCCTCATCATATCCTGCAGGAA
                       :::.:.:::: .::.::.::::::::::::::::: :: :::::::::::::::::::::::: :.:::::::::::
-----------------------AAACTGACTTTCGAGTTTAACAACAACCATGAGTCTCTGGACGAGGAGCTGCACCTCCTCATCTTGTCCTGCAGGAA
------------------------K--L--T--F--E--F--N--N--N--H--E--S--L--D--E--E--L--H--L--L--I--L--S--C--R--K

--------------------------------------------------------------------------------------------------->
--L--F--Y--F--K--I--W--A--F--L--D--V--S--F--V--E--R--I--L--K--S--Q--K--E--R--Q--C--A--L--R--V--F--K-
GTTGTTTTACTTCAAAATCTGGGCTTTCCTTGATGTTAGTTTTGTGGAGCGGATCCTGAAGAGTCAGAAAGAACGGCAGTGTGCCCTGCGTGTATTCAAG
:.::::::::::::::::::::::.:::::::::::::. ::::::::: :::::::::::::::::.::::: : ::::::::::::::...:.:::::
GCTGTTTTACTTCAAAATCTGGGCCTTCCTTGATGTTAAGTTTGTGGAGAGGATCCTGAAGAGTCAGGAAGAAGGCCAGTGTGCCCTGCGCACACTCAAG
--L--F--Y--F--K--I--W--A--F--L--D--V--K--F--V--E--R--I--L--K--S--Q--E--E--G--Q--C--A--L--R--T--L--K-

<---------------------------------------------------------------------------------------------------
-A--R--I--Y--T--N--R--Y--E--T--N--E--E--D--K--T--L--Q--E--I--Y--R--K--Y--R--K--L--I--E--S--E--L--S--
GCGAGAATTTATACAAACAGATATGAGACGAATGAAGAGGACAAGACCCTGCAGGAAATTTACAGGAAGTACAGAAAGCTGATCGAATCAGAGCTTAGCT
   ::::::::.:::::::::::::::::::::::::::::::..:: ::::.::::::::::::::::::::::::: ::::::: :::.::::.:.::
---AGAATTTACACAAACAGATATGAGACGAATGAAGAGGACAGAACACTGCGGGAAATTTACAGGAAGTACAGAAAGATGATCGACTCAAAGCTCAACT
----R--I--Y--T--N--R--Y--E--T--N--E--E--D--R--T--L--R--E--I--Y--R--K--Y--R--K--M--I--D--S--K--L--N--

---------------------------->
Y--F--V--I--V--Y--S--V--M--*-
ATTTTGTCATCGTTTACTCTGTGATGTAA
::::::::::::.::::.:..::::::.:
ATTTTGTCATCGCTTACCCCATGATGTGA
Y--F--V--I--A--Y--P--M--M--*-

Pig Consensus Sequence

>BGISUST0000901438
ATGGACGAAGAAGGCCAACTGCTGCAGCCTCAAGACCAGAGCTGCTGGGCCACTCTGCCTGATGTGTGTCTGCGTCGTGTTTTCTGGTGGCTAGGAGACA
GGGACAGGTCCAGGGCGGCCCTCGTCTGCAGAAAATGGAACCAGATAATGTATTCAGCTGACCTCTGGCGATACAGGACCATCACGTTCAGTGGAAGACC
TTCCAGGGTACACGCGTCTGAATTCGAGTCGGCTCTTTGGTATGTCAAGAAATTTGGTCGTTATCTGGAGCACCTGGAGATCAAATTCCTGAATCCTTAC
AATGCTGTCCTGACCAAGAAGTTCCAGGTCACCATGCGAGGCCTTCTCTCGTGTCTGGGCAAGAGTAACAACCGTCTCAGATCTCTGTCCATCCAGCACC
TGGAACTGGACCGCCTGGTCTGGAGGAACAGCATCCGGAGCTCATTCATGAAAAGCTTGAGCTTCTTCTTGAAAGAAATGGGCAAACACCTGGATTATCT
CAACCTGAAAGGGGCCAGG---------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------AAACTGACTTTCGAGTTTAACAACAACCATGAGTCTCTGGACGAGGAGCTGCACCTCCTCATCTTGTCCTGCAGGAA
GCTGTTTTACTTCAAAATCTGGGCCTTCCTTGATGTTAAGTTTGTGGAGAGGATCCTGAAGAGTCAGGAAGAAGGCCAGTGTGCCCTGCGCACACTCAAG
---AGAATTTACACAAACAGATATGAGACGAATGAAGAGGACAGAACACTGCGGGAAATTTACAGGAAGTACAGAAAGATGATCGACTCAAAGCTCAACT
ATTTTGTCATCGCTTACCCCATGATGTGA


>BGISUSP0000901438
MDEEGQLLQPQDQSCWATLPDVCLRRVFWWLGDRDRSRAALVCRKWNQIMYSADLWRYRTITFSGRPSRVHASEFESALWYVKKFGRYLEHLEIKFLNPY
NAVLTKKFQVTMRGLLSCLGKSNNRLRSLSIQHLELDRLVWRNSIRSSFMKSLSFFLKEMGKHLDYLNLKGAR---------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------KLTFEFNNNHESLDEELHLLILSCRKLFYFKIWAFLDVKFVERILKSQEEGQCALRTLK
-RIYTNRYETNEEDRTLREIYRKYRKMIDSKLNYFVIAYPMM*