Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000177283 (click for geneview)
Transcript ID ENST00000321644(link to ensembl)
Symbol FZD8
Localtion Chromosome:10:35968279:35970363:-1 band: 10p11.21
Description Frizzled 8 precursor (Frizzled-8) (Fz-8) (hFz8). [Source:Uniprot/SWISSPROT;Acc:Q9H461]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--W--G--Y--L--L--E--V--T--S--L--L--A--A--L--A--L--L--Q--R--S--S--G--A--A--A--A--S--A--K--E--L--
ATGGAGTGGGGTTACCTGTTGGAAGTGACCTCGCTGCTGGCCGCCTTGGCGCTGCTGCAGCGCTCTAGCGGCGCTGCGGCCGCCTCGGCCAAGGAGCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--C--Q--E--I--T--V--P--L--C--K--G--I--G--Y--N--Y--T--Y--M--P--N--Q--F--N--H--D--T--Q--D--E--A--G--L
CATGCCAAGAGATCACCGTGCCGCTGTGTAAGGGCATCGGCTACAACTACACCTACATGCCCAATCAGTTCAACCACGACACGCAAGACGAGGCGGGCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--V--H--Q--F--W--P--L--V--E--I--Q--C--S--P--D--L--K--F--F--L--C--S--M--Y--T--P--I--C--L--E--D--Y-
GGAGGTGCACCAGTTCTGGCCGCTGGTGGAGATCCAGTGCTCGCCCGATCTCAAGTTCTTCCTGTGCAGCATGTACACGCCCATCTGCCTAGAGGACTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--K--P--L--P--P--C--R--S--V--C--E--R--A--K--A--G--C--A--P--L--M--R--Q--Y--G--F--A--W--P--D--R--M--
AAGAAGCCGCTGCCGCCCTGCCGCTCGGTGTGCGAGCGCGCCAAGGCCGGCTGCGCGCCGCTCATGCGCCAGTACGGCTTCGCCTGGCCCGACCGCATGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--C--D--R--L--P--E--Q--G--N--P--D--T--L--C--M--D--Y--N--R--T--D--L--T--T--A--A--P--S--P--P--R--R--L
GCTGCGACCGGCTGCCCGAGCAAGGCAACCCTGACACGCTGTGCATGGACTACAACCGCACCGACCTAACCACCGCCGCGCCCAGCCCGCCGCGCCGCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--P--P--P--P--G--E--Q--P--P--S--G--S--G--H--G--R--P--P--G--A--R--P--P--H--R--G--G--G--R--G--G--G-
GCCGCCGCCGCCGCCCGGCGAGCAGCCGCCTTCGGGCAGCGGCCACGGCCGCCCGCCGGGGGCCAGGCCCCCGCACCGCGGCGGCGGCAGGGGCGGTGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--G--D--A--A--A--P--P--A--R--G--G--G--G--G--G--K--A--R--P--P--G--G--G--A--A--P--C--E--P--G--C--Q--
GGCGGGGACGCGGCGGCGCCCCCAGCTCGCGGCGGCGGCGGTGGCGGGAAGGCGCGGCCCCCTGGCGGCGGCGCGGCTCCCTGCGAGCCCGGGTGCCAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
C--R--A--P--M--V--S--V--S--S--E--R--H--P--L--Y--N--R--V--K--T--G--Q--I--A--N--C--A--L--P--C--H--N--P
GCCGCGCGCCTATGGTGAGCGTGTCCAGCGAGCGCCACCCGCTCTACAACCGCGTCAAGACAGGCCAGATCGCTAACTGCGCGCTGCCCTGCCACAACCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--F--F--S--Q--D--E--R--A--F--T--V--F--W--I--G--L--W--S--V--L--C--F--V--S--T--F--A--T--V--S--T--F--L-
CTTTTTCAGCCAGGACGAGCGCGCCTTCACCGTCTTCTGGATCGGCCTGTGGTCGGTGCTCTGCTTCGTGTCCACCTTCGCCACCGTCTCCACCTTCCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--D--M--E--R--F--K--Y--P--E--R--P--I--I--F--L--S--A--C--Y--L--F--V--S--V--G--Y--L--V--R--L--V--A--
ATCGACATGGAGCGCTTCAAGTACCCGGAGCGGCCCATTATCTTCCTCTCGGCCTGCTACCTCTTCGTGTCGGTGGGCTACCTAGTGCGCCTGGTGGCGG
                                          ::::::::::::::::::::::::::::: :: ::::::::.::::::::::::::::
------------------------------------------TTCCTCTCGGCCTGCTACCTCTTCGTGTCCGTCGGCTACCTGGTGCGCCTGGTGGCGG
-------------------------------------------F--L--S--A--C--Y--L--F--V--S--V--G--Y--L--V--R--L--V--A--

----------------------------------------------------------------------------------------------------
G--H--E--K--V--A--C--S--G--G--A--P--G--A--G--G--A--G--G--A--G--G--A--A--A--G--A--G--A--A--G--A--G--A
GCCACGAGAAGGTGGCGTGCAGCGGTGGCGCGCCGGGCGCGGGGGGCGCTGGGGGCGCGGGCGGCGCGGCGGCGGGCGCGGGCGCGGCGGGCGCGGGCGC
::::::::::::::::::::: :::.::.:::  :: .::::: ::::: :: :::::::::.::::::::::::: :: ::::::::::: ::::::::
GCCACGAGAAGGTGGCGTGCATCGGCGGTGCGGGGGCTGCGGGCGGCGCGGGCGGCGCGGGCAGCGCGGCGGCGGGAGCCGGCGCGGCGGGAGCGGGCGC
G--H--E--K--V--A--C--I--G--G--A--G--A--A--G--G--A--G--G--A--G--S--A--A--A--G--A--G--A--A--G--A--G--A

----------------------------------------------------------------------------------------------------
--G--G--P--G--G--R--G--E--Y--E--E--L--G--A--V--E--Q--H--V--R--Y--E--T--T--G--P--A--L--C--T--V--V--F-
GGGCGGCCCGGGCGGGCGCGGCGAGTACGAGGAGCTGGGCGCGGTGGAGCAGCACGTGCGCTACGAGACCACCGGCCCCGCGCTGTGCACCGTGGTCTTC
:::::::::::: ::::::::::::::::::::::::::::: ::::::::::::::::::::.:::::::: ::::: :::::::::::::::::::::
GGGCGGCCCGGGAGGGCGCGGCGAGTACGAGGAGCTGGGCGCCGTGGAGCAGCACGTGCGCTATGAGACCACGGGCCCGGCGCTGTGCACCGTGGTCTTC
--G--G--P--G--G--R--G--E--Y--E--E--L--G--A--V--E--Q--H--V--R--Y--E--T--T--G--P--A--L--C--T--V--V--F-

----------------------------------------------------------------------------------------------------
-L--L--V--Y--F--F--G--M--A--S--S--I--W--W--V--I--L--S--L--T--W--F--L--A--A--G--M--K--W--G--N--E--A--
TTGCTGGTCTACTTCTTCGGCATGGCCAGCTCCATCTGGTGGGTGATCTTGTCGCTCACATGGTTCCTGGCGGCCGGTATGAAGTGGGGCAACGAAGCCA
.:::: ::::::::::::::::::::::::::::::::::::::::::.::::::::::.:::::::::::::: ::.:::::::::::::::::.::::
CTGCTCGTCTACTTCTTCGGCATGGCCAGCTCCATCTGGTGGGTGATCCTGTCGCTCACGTGGTTCCTGGCGGCGGGCATGAAGTGGGGCAACGAGGCCA
-L--L--V--Y--F--F--G--M--A--S--S--I--W--W--V--I--L--S--L--T--W--F--L--A--A--G--M--K--W--G--N--E--A--

----------------------------------------------------------------------------------------------------
I--A--G--Y--S--Q--Y--F--H--L--A--A--W--L--V--P--S--V--K--S--I--A--V--L--A--L--S--S--V--D--G--D--P--V
TCGCCGGCTACTCGCAGTACTTCCACCTGGCCGCGTGGCTTGTGCCCAGCGTCAAGTCCATCGCGGTGCTGGCGCTCAGCTCGGTGGACGGCGACCCGGT
:::::::::::::::::::::::::::::::::: :::::.:::::::::::::::::.::::: :::::::::::::::::::::::::::::.:::::
TCGCCGGCTACTCGCAGTACTTCCACCTGGCCGCCTGGCTCGTGCCCAGCGTCAAGTCTATCGCCGTGCTGGCGCTCAGCTCGGTGGACGGCGATCCGGT
I--A--G--Y--S--Q--Y--F--H--L--A--A--W--L--V--P--S--V--K--S--I--A--V--L--A--L--S--S--V--D--G--D--P--V

----------------------------------------------------------------------------------------------------
--A--G--I--C--Y--V--G--N--Q--S--L--D--N--L--R--G--F--V--L--A--P--L--V--I--Y--L--F--I--G--T--M--F--L-
GGCGGGCATCTGCTACGTGGGCAACCAGAGCCTGGACAACCTGCGCGGCTTCGTGCTGGCGCCGCTGGTCATCTACCTCTTCATCGGCACCATGTTCCTG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGCGGGCATCTGCTACGTGGGCAACCAGAGCCTGGACAACCTGCGCGGCTTCGTGCTGGCGCCGCTGGTCATCTACCTCTTCATCGGCACCATGTTCCTG
--A--G--I--C--Y--V--G--N--Q--S--L--D--N--L--R--G--F--V--L--A--P--L--V--I--Y--L--F--I--G--T--M--F--L-

----------------------------------------------------------------------------------------------------
-L--A--G--F--V--S--L--F--R--I--R--S--V--I--K--Q--Q--D--G--P--T--K--T--H--K--L--E--K--L--M--I--R--L--
CTGGCCGGCTTCGTGTCCCTCTTCCGCATCCGCTCGGTCATCAAGCAACAGGACGGCCCCACCAAGACGCACAAGCTGGAGAAGCTGATGATCCGCCTGG
::::::::::::::::: :::::::::::::::::::::::::::::.::::. ::::::::::::::::::::.::::::::::: :::::::::::::
CTGGCCGGCTTCGTGTCGCTCTTCCGCATCCGCTCGGTCATCAAGCAGCAGGGAGGCCCCACCAAGACGCACAAACTGGAGAAGCTCATGATCCGCCTGG
-L--A--G--F--V--S--L--F--R--I--R--S--V--I--K--Q--Q--G--G--P--T--K--T--H--K--L--E--K--L--M--I--R--L--

----------------------------------------------------------------------------------------------------
G--L--F--T--V--L--Y--T--V--P--A--A--V--V--V--A--C--L--F--Y--E--Q--H--N--R--P--R--W--E--A--T--H--N--C
GCCTGTTCACCGTGCTCTACACCGTGCCCGCCGCGGTGGTGGTCGCCTGCCTCTTCTACGAGCAGCACAACCGCCCGCGCTGGGAGGCCACGCACAACTG
:::: ::::::::::::::::::::::::::::: :: :::::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::
GCCTCTTCACCGTGCTCTACACCGTGCCCGCCGCTGTCGTGGTCGCCTGTCTCTTCTACGAACAGCACAACCGCCCGCGCTGGGAGGCCACGCACAACTG
G--L--F--T--V--L--Y--T--V--P--A--A--V--V--V--A--C--L--F--Y--E--Q--H--N--R--P--R--W--E--A--T--H--N--C

----------------------------------------------------------------------------------------------------
--P--C--L--R--D--L--Q--P--D--Q--A--R--R--P--D--Y--A--V--F--M--L--K--Y--F--M--C--L--V--V--G--I--T--S-
CCCGTGCCTGCGGGACCTGCAGCCCGACCAGGCACGCAGGCCCGACTACGCCGTCTTCATGCTCAAGTACTTCATGTGCCTAGTGGTGGGCATCACCTCG
:::.:::::::::::::::::::: ::::::::.::: :::::                                                         
CCCATGCCTGCGGGACCTGCAGCCGGACCAGGCGCGCCGGCCC---------------------------------------------------------
--P--C--L--R--D--L--Q--P--D--Q--A--R--R--P----------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--V--W--V--W--S--G--K--T--L--E--S--W--R--S--L--C--T--R--C--C--W--A--S--K--G--A--A--V--G--G--G--A--
GGCGTGTGGGTCTGGTCCGGCAAGACGCTGGAGTCCTGGCGCTCCCTGTGCACCCGCTGCTGCTGGGCCAGCAAGGGCGCCGCGGTGGGCGGGGGCGCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--A--T--A--A--G--G--G--G--G--P--G--G--G--G--G--G--G--P--G--G--G--G--G--P--G--G--G--G--G--S--L--Y--S
GCGCCACGGCCGCGGGGGGTGGCGGCGGGCCGGGGGGCGGCGGCGGCGGGGGACCCGGCGGCGGCGGGGGGCCGGGCGGCGGCGGGGGCTCCCTCTACAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------------>
--D--V--S--T--G--L--T--W--R--S--G--T--A--S--S--V--S--Y--P--K--Q--M--P--L--S--Q--V--*-
CGACGTCAGCACTGGCCTGACGTGGCGGTCGGGCACGGCGAGCTCCGTGTCTTATCCAAAGCAGATGCCATTGTCCCAGGTCTGA
                                                                                     
-------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000885268
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------TTCCTCTCGGCCTGCTACCTCTTCGTGTCCGTCGGCTACCTGGTGCGCCTGGTGGCGG
GCCACGAGAAGGTGGCGTGCATCGGCGGTGCGGGGGCTGCGGGCGGCGCGGGCGGCGCGGGCAGCGCGGCGGCGGGAGCCGGCGCGGCGGGAGCGGGCGC
GGGCGGCCCGGGAGGGCGCGGCGAGTACGAGGAGCTGGGCGCCGTGGAGCAGCACGTGCGCTATGAGACCACGGGCCCGGCGCTGTGCACCGTGGTCTTC
CTGCTCGTCTACTTCTTCGGCATGGCCAGCTCCATCTGGTGGGTGATCCTGTCGCTCACGTGGTTCCTGGCGGCGGGCATGAAGTGGGGCAACGAGGCCA
TCGCCGGCTACTCGCAGTACTTCCACCTGGCCGCCTGGCTCGTGCCCAGCGTCAAGTCTATCGCCGTGCTGGCGCTCAGCTCGGTGGACGGCGATCCGGT
GGCGGGCATCTGCTACGTGGGCAACCAGAGCCTGGACAACCTGCGCGGCTTCGTGCTGGCGCCGCTGGTCATCTACCTCTTCATCGGCACCATGTTCCTG
CTGGCCGGCTTCGTGTCGCTCTTCCGCATCCGCTCGGTCATCAAGCAGCAGGGAGGCCCCACCAAGACGCACAAACTGGAGAAGCTCATGATCCGCCTGG
GCCTCTTCACCGTGCTCTACACCGTGCCCGCCGCTGTCGTGGTCGCCTGTCTCTTCTACGAACAGCACAACCGCCCGCGCTGGGAGGCCACGCACAACTG
CCCATGCCTGCGGGACCTGCAGCCGGACCAGGCGCGCCGGCCC---------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------


>BGISUSP0000885268
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------FLSACYLFVSVGYLVRLVAGHEKVACIGGAGAAGGAGGAGSAAAGAGAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVF
LLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFL
LAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRP-------------------
-----------------------------------------------------------------------------------------------