Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000178338 (click for geneview)
Transcript ID ENST00000322434(link to ensembl)
Symbol ZNF354B
Localtion Chromosome:5:178219560:178244635:1 band: 5q35.3
Description zinc finger protein 354B [Source:RefSeq_peptide;Acc:NP_478137]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------><------------------------------------------------------------------
-M--A--A--G--Q--R--E--A--R--P--Q--V--S--L--T--F--E--D--V--A--V--L--F--T--W--D--E--W--R--K--L--A--P--
ATGGCTGCTGGGCAGCGGGAAGCGAGGCCCCAGGTGTCACTGACATTCGAGGACGTGGCTGTGCTCTTTACCTGGGATGAGTGGAGAAAGCTGGCTCCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------><---------------------------------------
S--Q--R--N--L--Y--R--D--V--M--L--E--N--Y--R--N--L--V--S--L--G--L--S--F--T--K--P--K--V--I--S--L--L--Q
CTCAGAGAAACTTGTACCGGGATGTGATGCTGGAGAACTATAGGAACCTGGTCTCACTGGGACTCTCATTTACCAAACCAAAAGTCATCTCCCTGTTGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------><-------------------------------------------
--Q--G--E--D--P--W--E--V--E--K--D--S--S--G--V--S--S--L--G--C--K--S--T--P--K--M--T--K--S--T--Q--T--Q-
GCAAGGAGAAGATCCCTGGGAGGTGGAGAAAGACAGTTCTGGTGTCTCCTCTCTAGGATGTAAGAGCACACCTAAAATGACAAAGTCAACTCAAACTCAG
                                                          ::::::::::  :::::::. ::::::::::::::::::::.
----------------------------------------------------------TGTAAGAGCAGTCCTAAAACCACAAAGTCAACTCAAACTCAA
-----------------------------------------------------------C--K--S--S--P--K--T--T--K--S--T--Q--T--Q-

----------------------------------------------------------------------------------------------------
-D-----S--F--Q--E--Q--I--R--K--R--L--K--R--D--E--P--W--N--F--I--S--E--R--S--C--I--Y--E--E--K--L--K--
GAT---TCATTTCAGGAGCAGATAAGGAAAAGATTGAAAAGGGATGAACCCTGGAACTTCATATCAGAAAGATCCTGCATATATGAAGAGAAATTAAAGA
:..   ::::::..::.:: ::::::.::.:::.: ::::..:::::::::::::::::::::::  :::. .:::::::.:::::::: ::: ::::::
GGCTTGTCATTTTGGGGGCTGATAAGAAAGAGACTCAAAAAAGATGAACCCTGGAACTTCATATCCCAAAACCCCTGCATGTATGAAGACAAAATAAAGA
-G--L--S--F--W--G--L--I--R--K--R--L--K--K--D--E--P--W--N--F--I--S--Q--N--P--C--M--Y--E--D--K--I--K--

----------------------------------------------------------------------------------------------------
K--Q--Q--D--K--N--E--N--L--Q--I--I--S--V--A--H--T--K--I--L--T--V--D--R--S--H--K--N--V--E--F--G--Q--N
AACAGCAGGACAAAAATGAAAATTTACAAATAATTTCAGTTGCCCATACAAAAATCCTTACTGTAGATAGAAGCCATAAAAATGTTGAATTTGGCCAAAA
::::: :::::.:::::::::.::::::::: ::::::.:..::::::::.:::::::.:::.:::: ::::::::::::::.. ::: :::::::::::
AACAGAAGGACGAAAATGAAAGTTTACAAATTATTTCAATCACCCATACAGAAATCCTCACTATAGAAAGAAGCCATAAAAACAATGACTTTGGCCAAAA
K--Q--K--D--E--N--E--S--L--Q--I--I--S--I--T--H--T--E--I--L--T--I--E--R--S--H--K--N--N--D--F--G--Q--N

----------------------------------------------------------------------------------------------------
--F--Y--L--K--S--V--F--I--K--Q--Q--R--F--A--K--E--K--T--P--S--K--C--E--I--Q--R--N--S--F--K--Q--N--S-
CTTCTACCTGAAATCAGTCTTCATTAAGCAACAGAGATTTGCTAAAGAAAAAACTCCATCAAAATGTGAAATACAAAGAAATAGTTTCAAGCAGAATTCA
:::: .:::.:::::::: ::..:::::: ::::::..::::::.::::::::. ::.:::::::.::::::.:::::::::::.::.::.:::::::::
CTTCAGCCTAAAATCAGTGTTTGTTAAGCCACAGAGGCTTGCTAGAGAAAAAATACCGTCAAAATATGAAATGCAAAGAAATAGCTTTAAACAGAATTCA
--F--S--L--K--S--V--F--V--K--P--Q--R--L--A--R--E--K--I--P--S--K--Y--E--M--Q--R--N--S--F--K--Q--N--S-

----------------------------------------------------------------------------------------------------
-N--L--L--N--Q--S--K--I--K--T--A--E--K--R--Y--K--C--S--T--C--E--K--A--F--I--H--N--S--S--L--R--K--H--
AATTTACTTAACCAATCAAAAATCAAAACAGCAGAGAAACGCTATAAATGCAGTACATGTGAAAAAGCCTTCATTCACAATTCATCCCTTCGTAAACATC
:::::::::::::::.::::::: ::.::::::::.::::::::::::::.:.::.:::.::::::::::::::::::::::::::::::::::::::::
AATTTACTTAACCAACCAAAAATGAAGACAGCAGAAAAACGCTATAAATGTAATATATGCGAAAAAGCCTTCATTCACAATTCATCCCTTCGTAAACATC
-N--L--L--N--Q--P--K--M--K--T--A--E--K--R--Y--K--C--N--I--C--E--K--A--F--I--H--N--S--S--L--R--K--H--

----------------------------------------------------------------------------------------------------
Q--K--N--H--T--G--E--K--L--F--K--C--K--E--C--L--K--A--F--S--Q--S--S--A--L--I--Q--H--Q--R--T--H--T--G
AGAAAAACCACACTGGAGAAAAATTATTTAAATGTAAAGAATGTTTAAAAGCTTTCAGCCAAAGTTCTGCTCTTATTCAACATCAAAGAACTCATACAGG
::::::::::.::::::::.::::::::::::::::::::::::::.:::::.:::::::::::.:: ::::::::::::::::::::::::::::: ::
AGAAAAACCATACTGGAGAGAAATTATTTAAATGTAAAGAATGTTTGAAAGCCTTCAGCCAAAGCTCAGCTCTTATTCAACATCAAAGAACTCATACTGG
Q--K--N--H--T--G--E--K--L--F--K--C--K--E--C--L--K--A--F--S--Q--S--S--A--L--I--Q--H--Q--R--T--H--T--G

----------------------------------------------------------------------------------------------------
--E--K--P--Y--I--C--K--E--C--G--K--A--F--S--H--S--A--S--L--C--K--H--L--R--T--H--T--V--E--K--C--Y--R-
AGAGAAACCCTATATATGTAAAGAATGTGGGAAAGCCTTCAGCCATAGTGCATCCCTTTGTAAGCATTTAAGGACCCATACTGTGGAGAAATGCTATAGA
:::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::.::..::::.::::::::::::::.:::: ::::::.
AGAGAAACCCTATATATGTAAAGAATGCGGGAAAGCCTTCAGCCATAGTGCATCCCTTTGTAAACACCTAAGAACCCATACTGTGGAAAAATCCTATAGG
--E--K--P--Y--I--C--K--E--C--G--K--A--F--S--H--S--A--S--L--C--K--H--L--R--T--H--T--V--E--K--S--Y--R-

----------------------------------------------------------------------------------------------------
-C--K--E--C--G--K--S--F--S--R--R--S--G--L--F--I--H--Q--K--I--H--A--Q--E--N--P--H--K--Y--N--P--G--R--
TGTAAAGAATGTGGTAAATCCTTCAGTCGAAGGTCTGGGCTTTTTATACATCAAAAAATCCATGCTCAAGAAAATCCCCATAAATACAATCCAGGCAGGA
::::::::::::::::::::::::::.:::::::: :: ::::::::::::::.::.::::::::::.::: :: :::::.:::::.::.:::::. :::
TGTAAAGAATGTGGTAAATCCTTCAGCCGAAGGTCAGGCCTTTTTATACATCAGAAGATCCATGCTCGAGACAAGCCCCACAAATATAACCCAGGTCGGA
-C--K--E--C--G--K--S--F--S--R--R--S--G--L--F--I--H--Q--K--I--H--A--R--D--K--P--H--K--Y--N--P--G--R--

----------------------------------------------------------------------------------------------------
K--A--S--S--Y--S--T--S--L--S--G--S--Q--K--I--H--L--R--K--K--S--Y--L--C--N--E--C--G--N--T--F--K--S--S
AGGCATCCAGTTACAGCACTTCCCTTTCTGGAAGTCAGAAAATTCATCTCAGAAAGAAGTCCTACTTATGTAATGAATGTGGCAACACCTTTAAGTCTAG
::::::::: ::.:::::: ::::::.::::: ::::::.::::                                                        
AGGCATCCATTTGCAGCACATCCCTTCCTGGATGTCAGAGAATT--------------------------------------------------------
K--A--S--I--C--S--T--S--L--P--G--C--Q--R--I---------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--S--L--R--Y--H--Q--R--I--H--T--G--E--K--P--F--K--C--S--E--C--G--R--A--F--S--Q--S--A--S--L--I--Q-
CTCATCCCTTCGTTATCATCAGAGAATTCACACTGGAGAGAAGCCTTTTAAATGTAGTGAATGTGGGAGAGCCTTCAGCCAGAGTGCCTCTCTTATTCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-H--E--R--I--H--T--G--E--K--P--Y--R--C--N--E--C--G--K--G--F--T--S--I--S--R--L--N--R--H--R--I--I--H--
CATGAAAGAATTCACACCGGAGAAAAGCCCTATAGATGCAATGAATGTGGGAAAGGCTTTACTTCTATTTCACGACTTAATAGACACCGAATAATTCATA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--G--E--K--L--Y--N--C--N--E--C--G--K--A--L--S--S--H--S--T--L--I--I--H--E--R--I--H--T--G--E--K--P--C
CTGGAGAGAAATTGTATAATTGTAATGAATGTGGTAAAGCCTTAAGCTCCCACTCAACACTTATTATTCATGAGCGAATTCATACTGGAGAAAAACCATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--C--K--V--C--G--K--A--F--R--Q--S--S--A--L--I--Q--H--Q--R--M--H--T--G--E--R--P--Y--K--C--N--E--C-
TAAATGTAAAGTATGTGGAAAAGCCTTCAGACAGAGTTCCGCTCTCATTCAACATCAGAGAATGCATACTGGAGAAAGACCCTATAAGTGTAACGAATGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--K--T--F--R--C--N--S--S--L--S--N--H--Q--R--I--H--T--G--E--K--P--Y--R--C--L--E--C--G--M--S--F--G--
GACAAAACATTCAGGTGTAACTCATCGCTTAGTAATCACCAGAGAATTCATACTGGAGAGAAACCATATCGATGTTTAGAATGTGGGATGTCTTTTGGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Q--S--A--A--L--I--Q--H--Q--R--I--H--T--G--E--K--P--F--K--C--N--T--C--G--K--T--F--R--Q--S--S--S--L--I
AAAGTGCAGCTCTTATACAACATCAGAGGATTCATACAGGAGAAAAACCCTTTAAATGTAATACATGTGGAAAAACTTTTAGACAAAGCTCATCACTTAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--H--Q--R--I--H--T--G--E--K--P--Y--E--C--N--A--C--G--K--L--F--S--Q--R--S--S--L--T--N--H--Y--K--I-
TGCACATCAAAGAATTCATACTGGAGAGAAACCCTATGAATGTAATGCATGTGGGAAACTCTTTAGCCAGAGGTCATCCCTTACTAATCATTATAAAATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------->
-H--I--E--E--D--S--L--K--A--D--L--H--V--*-
CACATTGAAGAGGACTCCTTAAAAGCCGATTTGCATGTGTGA
                                          
------------------------------------------
------------------------------------------

Pig Consensus Sequence

>BGISUST0000891184
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------TGTAAGAGCAGTCCTAAAACCACAAAGTCAACTCAAACTCAA
GGCTTGTCATTTTGGGGGCTGATAAGAAAGAGACTCAAAAAAGATGAACCCTGGAACTTCATATCCCAAAACCCCTGCATGTATGAAGACAAAATAAAGA
AACAGAAGGACGAAAATGAAAGTTTACAAATTATTTCAATCACCCATACAGAAATCCTCACTATAGAAAGAAGCCATAAAAACAATGACTTTGGCCAAAA
CTTCAGCCTAAAATCAGTGTTTGTTAAGCCACAGAGGCTTGCTAGAGAAAAAATACCGTCAAAATATGAAATGCAAAGAAATAGCTTTAAACAGAATTCA
AATTTACTTAACCAACCAAAAATGAAGACAGCAGAAAAACGCTATAAATGTAATATATGCGAAAAAGCCTTCATTCACAATTCATCCCTTCGTAAACATC
AGAAAAACCATACTGGAGAGAAATTATTTAAATGTAAAGAATGTTTGAAAGCCTTCAGCCAAAGCTCAGCTCTTATTCAACATCAAAGAACTCATACTGG
AGAGAAACCCTATATATGTAAAGAATGCGGGAAAGCCTTCAGCCATAGTGCATCCCTTTGTAAACACCTAAGAACCCATACTGTGGAAAAATCCTATAGG
TGTAAAGAATGTGGTAAATCCTTCAGCCGAAGGTCAGGCCTTTTTATACATCAGAAGATCCATGCTCGAGACAAGCCCCACAAATATAACCCAGGTCGGA
AGGCATCCATTTGCAGCACATCCCTTCCTGGATGTCAGAGA-----------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------


>BGISUSP0000891184
--------------------------------------------------------------------------------------CKSSPKTTKSTQTQ
GLSFWGLIRKRLKKDEPWNFISQNPCMYEDKIKKQKDENESLQIISITHTEILTIERSHKNNDFGQNFSLKSVFVKPQRLAREKIPSKYEMQRNSFKQNS
NLLNQPKMKTAEKRYKCNICEKAFIHNSSLRKHQKNHTGEKLFKCKECLKAFSQSSALIQHQRTHTGEKPYICKECGKAFSHSASLCKHLRTHTVEKSYR
CKECGKSFSRRSGLFIHQKIHARDKPHKYNPGRKASICSTSLPGCQR-----------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------