Sequences
EST Library Info
cad1Unavailable
hlv1Heart, left ventricle
mcp1Mammae, collostrum producing
Clusters
Oligos
SNPs

Gene ID ENSG00000181222 (click for geneview)
Transcript ID ENST00000322644(link to ensembl)
Symbol POLR2A
Localtion Chromosome:17:7328422:7358653:1 band: 17p13.1
Description DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) (RPB1). [Source:Uniprot/SWISSPROT;Acc:P24928]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------------------><------
-M--H--G--G--G--P--P--S--G--D--S--A--C--P--L--R--T--I--K--R--V--Q--F--G--V--L--S--P--D--E--L--K--R--
ATGCACGGGGGTGGCCCCCCCTCGGGGGACAGCGCATGCCCGCTGCGCACCATCAAGAGAGTCCAGTTCGGAGTCCTGAGTCCGGATGAACTGAAGCGAA
::::::::::::::::::::::: ::::::::::::::::::::::::::::::::: :::: :::::::: ::::: ::::::::::::::::::::::
ATGCACGGGGGTGGCCCCCCCTCCGGGGACAGCGCATGCCCGCTGCGCACCATCAAGCGAGTGCAGTTCGGCGTCCTCAGTCCGGATGAACTGAAGCGAA
-M--H--G--G--G--P--P--S--G--D--S--A--C--P--L--R--T--I--K--R--V--Q--F--G--V--L--S--P--D--E--L--K--R--

----------------------------------------------------------------------------------------------------
M--S--V--T--E--G--G--I--K--Y--P--E--T--T--E--G--G--R--P--K--L--G--G--L--M--D--P--R--Q--G--V--I--E--R
TGTCTGTGACGGAGGGTGGCATCAAATACCCAGAGACGACTGAGGGAGGCCGCCCCAAGCTTGGGGGGCTGATGGACCCGAGGCAGGGGGTGATTGAGCG
::::.:::::::::::.::::::::::::::::::::.::.:::::::::::::::::::: ::::::::::::::.::.::::::::::::::.:::  
TGTCCGTGACGGAGGGCGGCATCAAATACCCAGAGACAACCGAGGGAGGCCGCCCCAAGCTGGGGGGGCTGATGGATCCAAGGCAGGGGGTGATCGAG--
M--S--V--T--E--G--G--I--K--Y--P--E--T--T--E--G--G--R--P--K--L--G--G--L--M--D--P--R--Q--G--V--I--E---

-------------------------><-------------------------------------------------------------------------
--T--G--R--C--Q--T--C--A--G--N--M--T--E--C--P--G--H--F--G--H--I--E--L--A--K--P--V--F--H--V--G--F--L-
GACTGGCCGCTGCCAAACATGTGCAGGAAACATGACAGAGTGTCCTGGCCACTTTGGCCACATTGAACTGGCCAAGCCTGTGTTTCACGTGGGCTTCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------><------------------------------------
-V--K--T--M--K--V--L--R--C--V--C--F--F--C--S--K--L--L--V--D--S--N--N--P--K--I--K--D--I--L--A--K--S--
GTGAAGACAATGAAAGTTTTGCGCTGTGTCTGCTTCTTCTGCTCCAAACTGCTTGTGGACTCTAACAACCCAAAGATCAAGGATATCCTGGCTAAGTCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--G--Q--P--K--K--R--L--T--H--V--Y--D--L--C--K--G--K--N--I--C--E--G--G--E--E--M--D--N--K--F--G--V--E
AGGGACAGCCCAAGAAGCGGCTCACACATGTCTACGACCTTTGCAAGGGCAAAAACATATGCGAGGGTGGGGAGGAGATGGACAACAAGTTCGGTGTGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------><--------------------------------------------------------------
--Q--P--E--G--D--E--D--L--T--K--E--K--G--H--G--G--C--G--R--Y--Q--P--R--I--R--R--S--G--L--E--L--Y--A-
ACAACCTGAGGGTGACGAGGATCTGACCAAAGAAAAGGGCCATGGTGGCTGTGGGCGGTACCAGCCCAGGATCCGGCGTTCTGGCCTAGAGTTGTATGCG
                                                          ::::::::::::::::::::.::.:::::.:::.:.::::: 
----------------------------------------------------------TACCAGCCCAGGATCCGGCGCTCCGGCCTGGAGCTATATGCC
-----------------------------------------------------------Y--Q--P--R--I--R--R--S--G--L--E--L--Y--A-

----------------------------------------------------------------------------------------------------
-E--W--K--H--V--N--E--D--S--Q--E--K--K--I--L--L--S--P--E--R--V--H--E--I--F--K--R--I--S--D--E--E--C--
GAATGGAAGCACGTTAATGAGGACTCTCAGGAGAAGAAGATCCTGCTGAGTCCAGAGCGAGTGCATGAGATCTTCAAACGCATCTCAGATGAGGAGTGTT
::.:::::::::::.::.:::::::: :::::::::::::::::::::::::: :::::.:::::.:::::::::::.::::::::.:::::::::::::
GAGTGGAAGCACGTCAACGAGGACTCGCAGGAGAAGAAGATCCTGCTGAGTCCCGAGCGGGTGCACGAGATCTTCAAGCGCATCTCGGATGAGGAGTGTT
-E--W--K--H--V--N--E--D--S--Q--E--K--K--I--L--L--S--P--E--R--V--H--E--I--F--K--R--I--S--D--E--E--C--

----------------------------------------------------------------------------------------------------
F--V--L--G--M--E--P--R--Y--A--R--P--E--W--M--I--V--T--V--L--P--V--P--P--L--S--V--R--P--A--V--V--M--Q
TTGTGCTGGGCATGGAGCCCCGCTATGCACGGCCAGAGTGGATGATTGTCACAGTGCTGCCTGTGCCCCCGCTCTCCGTGCGGCCTGCTGTTGTGATGCA
:.:: :::::::::::::: :::::.:: ::::: :::::::::::.::::: ::::::::.:::::::::::::::::::::::.::::: :: :::::
TCGTCCTGGGCATGGAGCCGCGCTACGCCCGGCCCGAGTGGATGATCGTCACCGTGCTGCCCGTGCCCCCGCTCTCCGTGCGGCCCGCTGTGGTCATGCA
F--V--L--G--M--E--P--R--Y--A--R--P--E--W--M--I--V--T--V--L--P--V--P--P--L--S--V--R--P--A--V--V--M--Q

------------------><--------------------------------------------------------------------------------
--G--S--A--R--N--Q--D--D--L--T--H--K--L--A--D--I--V--K--I--N--N--Q--L--R--R--N--E--Q--N--G--A--A--A-
GGGCTCTGCCCGTAACCAGGATGACCTGACTCACAAACTGGCTGACATCGTGAAGATCAACAATCAGCTGCGGCGCAATGAGCAGAACGGCGCAGCGGCC
::::::::::::.::::::::::::::::: :::::::::::.:::::::::::.:::::::::::::: ::::::::.::::::::::::::.::::::
GGGCTCTGCCCGCAACCAGGATGACCTGACGCACAAACTGGCCGACATCGTGAAAATCAACAATCAGCTTCGGCGCAACGAGCAGAACGGCGCGGCGGCC
--G--S--A--R--N--Q--D--D--L--T--H--K--L--A--D--I--V--K--I--N--N--Q--L--R--R--N--E--Q--N--G--A--A--A-

--------------------------------------------------------------------------------><------------------
-H--V--I--A--E--D--V--K--L--L--Q--F--H--V--A--T--M--V--D--N--E--L--P--G--L--P--R--A--M--Q--K--S--G--
CATGTCATTGCAGAGGATGTGAAGCTCCTCCAGTTCCATGTGGCCACCATGGTGGACAATGAGCTGCCTGGCTTGCCCCGTGCCATGCAGAAGTCTGGGC
::.:::::.:: :::::.:::::::::::::::::.::.::::::::::::::::::::.::::::::.:::.::::.   :::::::::::::::::::
CACGTCATCGCCGAGGACGTGAAGCTCCTCCAGTTTCACGTGGCCACCATGGTGGACAACGAGCTGCCCGGCCTGCCT---GCCATGCAGAAGTCTGGGC
-H--V--I--A--E--D--V--K--L--L--Q--F--H--V--A--T--M--V--D--N--E--L--P--G--L--P-----A--M--Q--K--S--G--

----------------------------------------------------------------------------------------------------
R--P--L--K--S--L--K--Q--R--L--K--G--K--E--G--R--V--R--G--N--L--M--G--K--R--V--D--F--S--A--R--T--V--I
GTCCCCTCAAGTCCCTGAAGCAGCGGTTGAAGGGCAAGGAAGGCCGGGTGCGAGGGAACCTGATGGGCAAAAGAGTGGACTTCTCGGCCCGTACTGTCAT
::::.::::::::::::::::::::::::::::::::::::::::: :::::.:::::::::::::::::. :.:::::::::::::::::.::.:::::
GTCCTCTCAAGTCCCTGAAGCAGCGGTTGAAGGGCAAGGAAGGCCGCGTGCGGGGGAACCTGATGGGCAAGCGGGTGGACTTCTCGGCCCGCACCGTCAT
R--P--L--K--S--L--K--Q--R--L--K--G--K--E--G--R--V--R--G--N--L--M--G--K--R--V--D--F--S--A--R--T--V--I

----------------------------------------------------------------------------------------------------
--T--P--D--P--N--L--S--I--D--Q--V--G--V--P--R--S--I--A--A--N--M--T--F--A--E--I--V--T--P--F--N--I--D-
CACCCCCGACCCCAACCTCTCCATTGACCAGGTTGGCGTGCCCCGCTCCATTGCTGCCAACATGACCTTTGCGGAGATTGTCACCCCCTTCAACATTGAC
::::::::::::::::::::::::.::::::::.::::::::.::::::::.::.::::::::::::::.::.:::::.:::::::::::::::::::::
CACCCCCGACCCCAACCTCTCCATCGACCAGGTCGGCGTGCCTCGCTCCATCGCCGCCAACATGACCTTCGCAGAGATCGTCACCCCCTTCAACATTGAC
--T--P--D--P--N--L--S--I--D--Q--V--G--V--P--R--S--I--A--A--N--M--T--F--A--E--I--V--T--P--F--N--I--D-

-><-------------------------------------------------------------------------------------------------
-R--L--Q--E--L--V--R--R--G--N--S--Q--Y--P--G--A--K--Y--I--I--R--D--N--G--D--R--I--D--L--R--F--H--P--
AGACTTCAAGAACTAGTGCGCAGGGGGAACAGCCAGTACCCAGGCGCCAAGTACATCATCCGAGACAATGGTGATCGCATTGACTTGCGTTTCCACCCCA
   :::::.::.::.::::::::::::::::::::::::::.:: :::::::::::::::::.:::::.::.::::::::::::::::::::::::::::
---CTTCAGGAGCTGGTGCGCAGGGGGAACAGCCAGTACCCGGGAGCCAAGTACATCATCCGGGACAACGGCGATCGCATTGACTTGCGTTTCCACCCCA
----L--Q--E--L--V--R--R--G--N--S--Q--Y--P--G--A--K--Y--I--I--R--D--N--G--D--R--I--D--L--R--F--H--P--

----------------------------------><----------------------------------------------------------------
K--P--S--D--L--H--L--Q--T--G--Y--K--V--E--R--H--M--C--D--G--D--I--V--I--F--N--R--Q--P--T--L--H--K--M
AGCCCAGTGACCTTCACCTGCAGACCGGCTATAAGGTGGAACGGCACATGTGTGATGGGGACATTGTTATCTTCAACCGGCAGCCAACTCTGCACAAAAT
::::::::::.::::::::::::::.:::::::::::::::::::::::::::::.:::::::: ::::::::::::::::::::::::.::::::::::
AGCCCAGTGATCTTCACCTGCAGACTGGCTATAAGGTGGAACGGCACATGTGTGACGGGGACATAGTTATCTTCAACCGGCAGCCAACTTTGCACAAAAT
K--P--S--D--L--H--L--Q--T--G--Y--K--V--E--R--H--M--C--D--G--D--I--V--I--F--N--R--Q--P--T--L--H--K--M

-----------------------------------------------------------><---------------------------------------
--S--M--M--G--H--R--V--R--I--L--P--W--S--T--F--R--L--N--L--S--V--T--T--P--Y--N--A--D--F--D--G--D--E-
GTCCATGATGGGGCATCGGGTCCGCATTCTCCCATGGTCTACCTTTCGCTTGAATCTTAGTGTGACAACTCCGTACAATGCAGACTTTGACGGGGATGAG
::::::::::::.:::::.::::: ::.::::: ::::::::.:::::::::::.                                       ::::::
GTCCATGATGGGACATCGAGTCCGGATCCTCCCNTGGTCTACTTTTCGCTTGAAC---------------------------------------GATGAG
--S--M--M--G--H--R--V--R--I--L--X--W--S--T--F--R--L--N-----------------------------------------D--E-

----------------------------------------------------------------------------------------------------
-M--N--L--H--L--P--Q--S--L--E--T--R--A--E--I--Q--E--L--A--M--V--P--R--M--I--V--T--P--Q--S--N--R--P--
ATGAACTTGCACCTGCCACAGTCTCTGGAGACGCGAGCAGAGATCCAGGAGCTGGCCATGGTTCCTCGCATGATTGTCACCCCCCAGAGCAATCGGCCTG
:::::::::::::::::.:::::.::.:::::.::.::.:::::::::::::: :::::::: :: ::::::::::::::::::::::::::::: ::.:
ATGAACTTGCACCTGCCGCAGTCCCTAGAGACACGGGCGGAGATCCAGGAGCTTGCCATGGTGCCACGCATGATTGTCACCCCCCAGAGCAATCGCCCCG
-M--N--L--H--L--P--Q--S--L--E--T--R--A--E--I--Q--E--L--A--M--V--P--R--M--I--V--T--P--Q--S--N--R--P--

----------------------------------------------------------------------><----------------------------
V--M--G--I--V--Q--D--T--L--T--A--V--R--K--F--T--K--R--D--V--F--L--E--R--G--E--V--M--N--L--L--M--F--L
TCATGGGTATTGTGCAGGACACACTCACAGCAGTGCGCAAATTCACCAAGAGAGACGTCTTCCTGGAGCGGGGTGAAGTGATGAACCTCCTGATGTTCCT
:::::::.::::::::::::::.:: :: :::::::::::::::::::::::.::::::::::::::::::                             
TCATGGGCATTGTGCAGGACACGCTGACTGCAGTGCGCAAATTCACCAAGAGGGACGTCTTCCTGGAGCGG-----------------------------
V--M--G--I--V--Q--D--T--L--T--A--V--R--K--F--T--K--R--D--V--F--L--E--R------------------------------

----------------------------------------------------------------------------------------------------
--S--T--W--D--G--K--V--P--Q--P--A--I--L--K--P--R--P--L--W--T--G--K--Q--I--F--S--L--I--I--P--G--H--I-
GTCGACGTGGGATGGGAAGGTCCCACAGCCGGCCATCCTAAAGCCCCGGCCCCTGTGGACAGGCAAGCAAATCTTCTCCCTCATCATACCTGGTCACATC
                                        ::::::::::::::::::::.:: :::::.::::::::::::::::::::.::.::::::
----------------------------------------AAGCCCCGGCCCCTGTGGACGGGGAAGCAGATCTTCTCCCTCATCATACCCGGCCACATC
-----------------------------------------K--P--R--P--L--W--T--G--K--Q--I--F--S--L--I--I--P--G--H--I-

--------------------------------------------------------------------------------><------------------
-N--C--I--R--T--H--S--T--H--P--D--D--E--D--S--G--P--Y--K--H--I--S--P--G--D--T--K--V--V--V--E--N--G--
AATTGTATCCGTACCCACAGTACCCATCCCGATGATGAAGACAGTGGCCCTTACAAGCACATCTCTCCTGGGGACACCAAGGTGGTGGTGGAGAATGGGG
::.::::::::.::::::::.::::::::.:::::.::.:::::.::::: ::::::::::::::::::::::::::::::::::::::::::::.::::
AACTGTATCCGCACCCACAGCACCCATCCTGATGACGAGGACAGCGGCCCGTACAAGCACATCTCTCCTGGGGACACCAAGGTGGTGGTGGAGAACGGGG
-N--C--I--R--T--H--S--T--H--P--D--D--E--D--S--G--P--Y--K--H--I--S--P--G--D--T--K--V--V--V--E--N--G--

----------------------------------------------------------------------------------------------------
E--L--I--M--G--I--L--C--K--K--S--L--G--T--S--A--G--S--L--V--H--I--S--Y--L--E--M--G--H--D--I--T--R--L
AGCTGATCATGGGCATCCTGTGTAAGAAGTCTCTGGGCACGTCAGCTGGCTCCCTGGTCCACATCTCCTACCTAGAGATGGGTCATGACATCACTCGCCT
::::::::::::::::::::::::::::::::::::::::::: ::::::::::: :::::::::::.::::: :::::::::::.::::::::::::::
AGCTGATCATGGGCATCCTGTGTAAGAAGTCTCTGGGCACGTCCGCTGGCTCCCTCGTCCACATCTCTTACCTTGAGATGGGTCACGACATCACTCGCCT
E--L--I--M--G--I--L--C--K--K--S--L--G--T--S--A--G--S--L--V--H--I--S--Y--L--E--M--G--H--D--I--T--R--L

-------------------------------------------------><-------------------------------------------------
--F--Y--S--N--I--Q--T--V--I--N--N--W--L--L--I--E--G--H--T--I--G--I--G--D--S--I--A--D--S--K--T--Y--Q-
CTTCTACTCCAACATTCAGACTGTCATTAACAACTGGCTCCTCATCGAGGGTCATACTATTGGCATTGGGGACTCCATTGCTGATTCTAAGACTTACCAG
::::::.::::::::::::::.:::::::::::::::::::::::::::   :::::.::::::::.::::::::::::::::::::::::::::::::.
CTTCTATTCCAACATTCAGACCGTCATTAACAACTGGCTCCTCATCGAG---CATACCATTGGCATCGGGGACTCCATTGCTGATTCTAAGACTTACCAA
--F--Y--S--N--I--Q--T--V--I--N--N--W--L--L--I--E-----H--T--I--G--I--G--D--S--I--A--D--S--K--T--Y--Q-

--------------------------------------------><------------------------------------------------------
-D--I--Q--N--T--I--K--K--A--K--Q--D--V--I--E--V--I--E--K--A--H--N--N--E--L--E--P--T--P--G--N--T--L--
GACATTCAGAACACTATTAAGAAGGCCAAGCAGGACGTAATAGAGGTCATCGAGAAGGCACACAACAATGAGCTGGAGCCCACCCCAGGGAACACTCTGC
:::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::.::.:::::.::::::::::::::::: :::::::::::::
GACATTCAGAACACTATTAAGAAGGCCAAGCAGGATGTAATAGAGGTCATCGAGAAGGCGCATAACAACGAGCTGGAGCCCACCCCCGGGAACACTCTGC
-D--I--Q--N--T--I--K--K--A--K--Q--D--V--I--E--V--I--E--K--A--H--N--N--E--L--E--P--T--P--G--N--T--L--

----------------------------------------------------------------------------------------------------
R--Q--T--F--E--N--Q--V--N--R--I--L--N--D--A--R--D--K--T--G--S--S--A--Q--K--S--L--S--E--Y--N--N--F--K
GGCAGACGTTTGAGAATCAGGTGAACCGCATTCTTAACGATGCCCGAGACAAGACTGGCTCCTCTGCTCAGAAATCCCTGTCTGAATACAATAACTTCAA
::::::: ::::::::.:::::::::::::::::.::.::::::::::::::::::::::::::.::.:::::::::::::::::::::::.:::::.::
GGCAGACCTTTGAGAACCAGGTGAACCGCATTCTCAATGATGCCCGAGACAAGACTGGCTCCTCCGCCCAGAAATCCCTGTCTGAATACAACAACTTTAA
R--Q--T--F--E--N--Q--V--N--R--I--L--N--D--A--R--D--K--T--G--S--S--A--Q--K--S--L--S--E--Y--N--N--F--K

------------------------------------------------><--------------------------------------------------
--S--M--V--V--S--G--A--K--G--S--K--I--N--I--S--Q--V--I--A--V--V--G--Q--Q--N--V--E--G--K--R--I--P--F-
GTCTATGGTCGTGTCCGGAGCTAAAGGTTCCAAGATTAACATCTCCCAGGTCATTGCTGTCGTTGGACAGCAGAACGTCGAGGGCAAGCGGATTCCATTT
:::::::::::::::.::.::.::::::::::::::.::::::::::::::::::::::::::.::.::::::::.:: ::::::::::::::.::::::
GTCTATGGTCGTGTCTGGGGCCAAAGGTTCCAAGATCAACATCTCCCAGGTCATTGCTGTCGTCGGGCAGCAGAATGTGGAGGGCAAGCGGATCCCATTT
--S--M--V--V--S--G--A--K--G--S--K--I--N--I--S--Q--V--I--A--V--V--G--Q--Q--N--V--E--G--K--R--I--P--F-

----------------------------------------------------------------------------------------------------
----G--F--K--H--R--T--L--P--H--F--I--K--D--D--Y--G--P--E--S--R--G--F--V--E--N--S--Y--L--A--G--L--T--
---GGCTTCAAGCACCGGACTCTGCCTCACTTCATCAAGGATGACTACGGGCCTGAGAGCCGTGGCTTTGTGGAGAACTCCTACCTAGCCGGCCTCACAC
   :: :::::::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::  ::::::::.:::::::::::::
T--GGATTCAAGCACCGGACTCTGCCTCACTTCATCAAGGATGACTATGGGCCCGAGAGCCGTGGCTTTGTGGAGAC-TCCTACCTGGCCGGCCTCACAC
-\--G--F--K--H--R--T--L--P--H--F--I--K--D--D--Y--G--P--E--S--R--G--F--V--E--N--S--Y--L--A--G--L--T--

-----------------------------------------------------------------------------><---------------------
P--T--E--F--F--F--H--A--M--G--G--R--E--G--L--I--D--T--A--V--K--T--A--E--T--G--Y--I--Q--R--R--L--I--K
CCACTGAGTTCTTTTTCCACGCCATGGGGGGTCGTGAGGGGCTCATTGACACGGCTGTCAAGACTGCTGAGACTGGATACATCCAGCGGCGGCTGATCAA
::::.::::::::.::::::::::::::::::::::::::::::::.:::::.:: :::::::::                                   
CCACCGAGTTCTTCTTCCACGCCATGGGGGGTCGTGAGGGGCTCATCGACACAGCGGTCAAGACT-----------------------------------
P--T--E--F--F--F--H--A--M--G--G--R--E--G--L--I--D--T--A--V--K--T------------------------------------

----------------------------------------------------------------------------------------------------
--S--M--E--S--V--M--V--K--Y--D--A--T--V--R--N--S--I--N--Q--V--V--Q--L--R--Y--G--E--D--G--L--A--G--E-
GTCCATGGAGTCAGTGATGGTGAAGTACGACGCGACTGTGCGGAACTCCATCAACCAGGTGGTGCAGCTGCGCTACGGCGAAGACGGCCTGGCAGGCGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------><-------------------------------------
-S--V--E--F--Q--N--L--A--T--L--K--P--S--N--K--A--F--E--K--K--F--R--F--D--Y--T--N--E--R--A--L--R--R--
AGCGTTGAGTTCCAGAACCTGGCTACGCTTAAGCCTTCCAACAAGGCTTTTGAGAAGAAGTTCCGCTTTGATTATACCAATGAGAGGGCCCTGCGGCGCA
                                                            ::::::::.:::::::::::.::: :::::::::::::::
------------------------------------------------------------TTCCGCTTCGATTATACCAACGAGCGGGCCCTGCGGCGCA
-------------------------------------------------------------F--R--F--D--Y--T--N--E--R--A--L--R--R--

----------------------------------------------------------------------------------------------------
T--L--Q--E--D--L--V--K--D--V--L--S--N--A--H--I--Q--N--E--L--E--R--E--F--E--R--M--R--E--D--R--E--V--L
CTCTGCAGGAGGACCTGGTGAAGGACGTGCTGAGCAACGCACACATCCAGAACGAGTTGGAGCGGGAATTTGAGCGGATGCGGGAGGATCGGGAGGTGCT
: ::::::::::::::::::::::::::::: ::::::::.:::::.:::::::::.:::::::::::::.::::::::::: :::::.:::::::::::
CGCTGCAGGAGGACCTGGTGAAGGACGTGCTCAGCAACGCGCACATTCAGAACGAGCTGGAGCGGGAATTCGAGCGGATGCGTGAGGACCGGGAGGTGCT
T--L--Q--E--D--L--V--K--D--V--L--S--N--A--H--I--Q--N--E--L--E--R--E--F--E--R--M--R--E--D--R--E--V--L

---------------------------------><-----------------------------------------------------------------
--R--V--I--F--P--T--G--D--S--K--V--V--L--P--C--N--L--L--R--M--I--W--N--A--Q--K--I--F--H--I--N--P--R-
CAGGGTCATCTTCCCAACTGGAGACAGCAAGGTCGTCCTCCCCTGTAACCTGCTGCGGATGATCTGGAATGCTCAGAAAATCTTCCACATCAACCCACGC
: :::::::::::::::: :: ::::::::::: ::::::::::::::::::::::: :::::::::::.::.:::::.::::::               
CCGGGTCATCTTCCCAACGGGTGACAGCAAGGTGGTCCTCCCCTGTAACCTGCTGCGCATGATCTGGAACGCCCAGAAGATCTTC---------------
--R--V--I--F--P--T--G--D--S--K--V--V--L--P--C--N--L--L--R--M--I--W--N--A--Q--K--I--F----------------

---------------------------------------><-----------------------------------------------------------
-L--P--S--D--L--H--P--I--K--V--V--E--G--V--K--E--L--S--K--K--L--V--I--V--N--G--D--D--P--L--S--R--Q--
CTTCCCTCCGACCTGCACCCCATCAAAGTGGTGGAGGGAGTCAAGGAATTGAGCAAGAAGCTGGTGATTGTGAATGGGGATGACCCACTAAGTCGACAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--Q--E--N--A--T--L--L--F--N--I--H--L--R--S--T--L--C--S--R--R--M--A--E--E--F--R--L--S--G--E--A--F--D
CCCAGGAAAATGCCACGCTGCTCTTCAACATCCACCTGCGGTCCACGTTGTGTTCCCGCCGCATGGCAGAGGAGTTTCGGCTCAGTGGGGAGGCCTTCGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------><-----------------------------------------------------
--W--L--L--G--E--I--E--S--K--F--N--Q--A--I--A--H--P--G--E--M--V--G--A--L--A--A--Q--S--L--G--E--P--A-
CTGGCTGCTTGGGGAGATTGAGTCCAAGTTCAACCAAGCCATTGCGCATCCCGGGGAAATGGTGGGGGCTCTGGCTGCGCAGTCCCTTGGAGAACCTGCC
                                           :: ::::::::.::.::::::::.:::::::::::.:::::::::::::::::.:::
-------------------------------------------GCCCATCCCGGAGAGATGGTGGGAGCTCTGGCTGCACAGTCCCTTGGAGAACCCGCC
--------------------------------------------A--H--P--G--E--M--V--G--A--L--A--A--Q--S--L--G--E--P--A-

----------------------------------------------------------------------------------------------------
-T--Q--M--T--L--N--T--F--H--Y--A--G--V--S--A--K--N--V--T--L--G--V--P--R--L--K--E--L--I--N--I--S--K--
ACCCAGATGACCTTGAATACCTTCCACTATGCTGGTGTGTCTGCCAAGAATGTGACGCTGGGTGTGCCCCGACTTAAGGAGCTCATCAACATTTCCAAGA
:::::::::::::::::.::::::::::::::.::::::::.::::::::.::::: :::::::::::::: ::::::::::::::::::::::::::::
ACCCAGATGACCTTGAACACCTTCCACTATGCCGGTGTGTCCGCCAAGAACGTGACCCTGGGTGTGCCCCGCCTTAAGGAGCTCATCAACATTTCCAAGA
-T--Q--M--T--L--N--T--F--H--Y--A--G--V--S--A--K--N--V--T--L--G--V--P--R--L--K--E--L--I--N--I--S--K--

-------------------------------------------------------------------------><-------------------------
K--P--K--T--P--S--L--T--V--F--L--L--G--Q--S--A--R--D--A--E--R--A--K--D--I--L--C--R--L--E--H--T--T--L
AGCCAAAGACTCCTTCGCTTACTGTCTTCCTGTTGGGCCAGTCCGCTCGAGATGCTGAGAGAGCCAAGGATATTCTGTGCCGTCTGGAGCATACAACGTT
::::::::::.::.:::::.::::::::::::.: ::::::::.:::::::::::.::::::                                      
AGCCAAAGACCCCCTCGCTCACTGTCTTCCTGCT-GGCCAGTCTGCTCGAGATGCCGAGAGA--------------------------------------
K--P--K--T--P--S--L--T--V--F--L--L--G--Q--S--A--R--D--A--E--R---------------------------------------

----------------------------------------------------------------------------------------------------
--R--K--V--T--A--N--T--A--I--Y--Y--D--P--N--P--Q--S--T--V--V--A--E--D--Q--E--W--V--N--V--Y--Y--E--M-
GAGGAAGGTGACTGCCAACACAGCCATCTACTATGACCCCAACCCCCAGAGCACGGTGGTGGCAGAGGATCAGGAATGGGTGAATGTCTACTATGAAATG
                                                 :::::.::::::::::::::.::::::::::::::::: ::::::::.:::
-------------------------------------------------AGCACAGTGGTGGCAGAGGACCAGGAATGGGTGAATGTGTACTATGAGATG
--------------------------------------------------S--T--V--V--A--E--D--Q--E--W--V--N--V--Y--Y--E--M-

----------------------------------------------------------------------------------------------------
-P--D--F--D--V--A--R--I--S--P--W--L--L--R--V--E--L--D--R--K--H--M--T--D--R--K--L--T--M--E--Q--I--A--
CCTGACTTTGATGTGGCCCGAATCTCCCCCTGGCTGTTGCGGGTGGAGCTGGATCGGAAGCACATGACTGACCGGAAGCTCACCATGGAGCAGATTGCTG
::.:::::.::.::::::::::::::::::::::: .::::::::::::::::.:::::::::::::::::::::::::: :::::::::::::::::.:
CCCGACTTCGACGTGGCCCGAATCTCCCCCTGGCTTCTGCGGGTGGAGCTGGACCGGAAGCACATGACTGACCGGAAGCTGACCATGGAGCAGATTGCCG
-P--D--F--D--V--A--R--I--S--P--W--L--L--R--V--E--L--D--R--K--H--M--T--D--R--K--L--T--M--E--Q--I--A--

--------------------><------------------------------------------------------------------------------
E--K--I--N--A--G--F--G--D--D--L--N--C--I--F--N--D--D--N--A--E--K--L--V--L--R--I--R--I--M--N--S--D--E
AAAAGATCAATGCTGGTTTTGGTGACGACTTGAACTGCATCTTTAATGATGACAATGCAGAGAAGCTGGTGCTCCGTATTCGCATCATGAACAGCGATGA
::::::::::::::   ::.:::::::::.::::.::::::::::::::.::.:::::::::::::::::.::::::::.:::::.::::::::.:::::
AAAAGATCAATGCT---TTCGGTGACGACCTGAATTGCATCTTTAATGACGATAATGCAGAGAAGCTGGTACTCCGTATCCGCATTATGAACAGTGATGA
E--K--I--N--A-----F--G--D--D--L--N--C--I--F--N--D--D--N--A--E--K--L--V--L--R--I--R--I--M--N--S--D--E

---------------------><-----------------------------------------------------------------------------
--N--K--M--Q--E--E--E--E--V--V--D--K--M--D--D--D--V--F--L--R--C--I--E--S--N--M--L--T--D--M--T--L--Q-
GAACAAGATGCAAGAGGAGGAAGAGGTGGTGGACAAGATGGATGATGATGTCTTCCTGCGCTGCATCGAGTCCAACATGCTGACAGATATGACCCTGCAG
.:::::::::::::::::.::::::::::::::::::::::::: .::.::::::::::::::::::::::::::::::::::: ::.::: ::::::::
AAACAAGATGCAAGAGGAAGAAGAGGTGGTGGACAAGATGGATGCCGACGTCTTCCTGCGCTGCATCGAGTCCAACATGCTGACCGACATGTCCCTGCAG
--N--K--M--Q--E--E--E--E--V--V--D--K--M--D--A--D--V--F--L--R--C--I--E--S--N--M--L--T--D--M--S--L--Q-

--------------------------><------------------------------------------------------------------------
-G--I--E--Q--I--S--K--V--Y--M--H--L--P--Q--T--D--N--K--K--K--I--I--I--T--E--D--G--E--F--K--A--L--Q--
GGCATCGAGCAGATCAGCAAGGTGTACATGCACTTGCCACAGACAGACAACAAGAAGAAGATCATCATCACGGAGGATGGGGAATTCAAGGCCCTGCAGG
:: ::::::::::::::::::::::: ::::::.::::.:::::.:::::::::::::::::::::                                  
GGGATCGAGCAGATCAGCAAGGTGTAAATGCACCTGCCGCAGACGGACAACAAGAAGAAGATCATC----------------------------------
-G--I--E--Q--I--S--K--V--*--M--H--L--P--Q--T--D--N--K--K--K--I--I-----------------------------------

----------------------------------------------------------------------------------------------------
E--W--I--L--E--T--D--G--V--S--L--M--R--V--L--S--E--K--D--V--D--P--V--R--T--T--S--N--D--I--V--E--I--F
AGTGGATCCTGGAGACGGACGGCGTGAGCTTGATGCGGGTGCTGAGTGAGAAGGACGTGGACCCCGTACGCACCACGTCCAATGACATTGTGGAGATCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------><-----------------------------------------------------------------------------------------
--T--V--L--G--I--E--A--V--R--K--A--L--E--R--E--L--Y--H--V--I--S--F--D--G--S--Y--V--N--Y--R--H--L--A-
CACGGTGCTGGGCATTGAAGCCGTGCGGAAGGCCCTGGAGCGGGAGCTGTACCACGTCATCTCCTTTGATGGCTCCTATGTCAATTACCGACACTTGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--L--C--D--T--M--T--C--R--G--H--L--M--A--I--T--R--H--G--V--N--R--Q--D--T--G--P--L--M--K--C--S--F--
CTCTTGTGTGATACCATGACCTGTCGTGGCCACTTGATGGCCATCACCCGACACGGAGTCAACCGCCAGGACACAGGACCACTCATGAAGTGTTCCTTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------><-------------------------------------------------------------------------------------
E--E--T--V--D--V--L--M--E--A--A--A--H--G--E--S--D--P--M--K--G--V--S--E--N--I--M--L--G--Q--L--A--P--A
AGGAAACGGTGGACGTGCTTATGGAAGCAGCCGCACACGGTGAGAGTGACCCCATGAAGGGGGTCTCTGAGAATATCATGCTGGGCCAGCTGGCTCCGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--T--G--C--F--D--L--L--L--D--A--E--K--C--K--Y--G--M--E--I--P--T--N--I--P--G--L--G--A--A--G--P--T-
CGGCACTGGCTGCTTTGACCTCCTGCTTGATGCAGAGAAGTGCAAGTATGGCATGGAGATCCCCACCAATATCCCCGGCCTGGGGGCTGCTGGACCCACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

><--------------------------------------------------------------------------------------------------
-G--M--F--F--G--S--A--P--S--P--M--G--G--I--S--P--A--M--T--P--W--N--Q--G--A--T--P--A--Y--G--A--W--S--
GGCATGTTCTTTGGTTCAGCACCCAGTCCCATGGGTGGAATCTCTCCTGCCATGACACCTTGGAACCAGGGTGCAACCCCTGCCTATGGCGCCTGGTCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------><--------------------------------------------------------------------------------
P--S--V--G--D--G--M--T--P--G--A--A--G--F--S--P--S--A--A--S--D--A--S--G--F--S--P--G--Y--S--P--A--W--S
CCAGTGTTGGTGATGGAATGACCCCAGGGGCAGCCGGCTTCTCTCCCAGTGCTGCGTCAGATGCCAGCGGCTTCAGCCCAGGTTACTCCCCTGCCTGGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------><----------------------------------
--P--T--P--G--S--P--G--S--P--G--P--S--S--P--Y--I--P--S--P--G--G--A--M--S--P--S--Y--S--P--T--S--P--A-
TCCCACACCGGGCTCCCCGGGGTCCCCAGGTCCCTCAAGCCCCTACATCCCTTCACCAGGTGGTGCCATGTCTCCCAGCTACTCGCCAACGTCACCTGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Y--E--P--R--S--P--G--G--Y--T--P--Q--S--P--S--Y--S--P--T--S--P--S--Y--S--P--T--S--P--S--Y--S--P--T--
TACGAGCCCCGCTCTCCTGGGGGCTACACACCCCAGAGTCCCTCTTATTCCCCCACTTCACCCTCCTACTCCCCTACCTCTCCATCCTATTCTCCAACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--P--N--Y--S--P--T--S--P--S--Y--S--P--T--S--P--S--Y--S--P--T--S--P--S--Y--S--P--T--S--P--S--Y--S--P
GTCCCAACTATAGTCCCACATCACCCAGCTATTCGCCAACGTCACCCAGCTACTCACCGACCTCTCCCAGCTACTCACCCACCTCTCCCAGCTACTCGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--S--P--S--Y--S--P--T--S--P--S--Y--S--P--T--S--P--S--Y--S--P--T--S--P--S--Y--S--P--T--S--P--S--Y-
CACCTCTCCCAGCTACTCGCCCACCTCTCCCAGCTACTCACCCACTTCCCCTAGCTACTCGCCCACTTCCCCTAGCTACTCGCCAACGTCTCCCAGCTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--P--T--S--P--S--Y--S--P--T--S--P--S--Y--S--P--T--S--P--S--Y--S--P--T--S--P--S--Y--S--P--T--S--P--
TCACCGACATCTCCCAGCTACTCGCCAACTTCACCCAGCTATTCTCCCACTTCTCCCAGCTACTCACCTACCTCTCCAAGCTATTCACCCACCTCCCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--Y--S--P--T--S--P--S--Y--S--P--T--S--P--N--Y--S--P--T--S--P--N--Y--T--P--T--S--P--S--Y--S--P--T--S
GCTACTCACCCACTTCCCCAAGTTACTCACCCACCAGCCCGAACTATTCTCCAACCAGTCCCAATTACACCCCAACATCACCCAGCTACAGCCCGACATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--S--Y--S--P--T--S--P--N--Y--T--P--T--S--P--N--Y--S--P--T--S--P-----S--Y--S--P--T--S-----P--S--Y-
ACCCAGCTATTCACCTACTAGTCCCAACTACACACCTACCAGCCCTAACTACAGCCCAACCTCTCCA---AGCTACTCTCCAACATCA---CCCAGCTAT
                                                       :::::::: ::    ::::::::.:: :: ::    ::::::::.
-------------------------------------------------------CCAACCTCGCCTG--AGCTACTCCCCCACTTCTG--CCCAGCTAC
--------------------------------------------------------P--T--S--P--\--S--Y--S--P--T--S--\--P--S--Y-

----------------------------------------------------------------------------------------------------
-S--P--T--S--P-----S--Y--S--P--S--S--P--R--Y--T--P--Q--S--P--T--Y--T--P--S--S--P--S--Y-----S--P--S--
TCCCCGACCTCACCA---AGTTACTCCCCTTCCAGCCCACGATACACACCACAGTCTCCAACCTATACCCCAAGCTCACCCAGCTAC---AGCCCCAGCT
:::::::::::.::    ::.::::::::::: :::::::::::::: :: :::::::: ::::::::::::::::: :::::::::    :::::::::
TCCCCGACCTCGCCTG--AGCTACTCCCCTTCGAGCCCACGATACACCCCCCAGTCTCCCACCTATACCCCAAGCTCCCCCAGCTACA--TGCCCCAGCT
-S--P--T--S--P--\--S--Y--S--P--S--S--P--R--Y--T--P--Q--S--P--T--Y--T--P--S--S--P--S--Y--\--S--P--S--

----------------------------------------------------------------------------------------------------
S--P--S--Y--S--P--A--S--P-----K--Y--T--P--T--S--P--S--Y-----S--P--S--S--P-----E--Y--T--P-----T--S--P
CGCCCAGCTACAGCCCAGCCTCACCC---AAGTACACCCCAACCAGTCCTTCTTAC---AGTCCCAGCTCCCCA---GAGTATACCCCA---ACCTCTCC
: :::::::::::::: .::::.:::   : :::::::::::::::::::::.:::    :.:::::::: ::.   :::::.:::::    ::::::::
CCCCCAGCTACAGCCCTACCTCGCCCA--ATGTACACCCCAACCAGTCCTTCCTACA--TGCCCCAGCTCGCCGT--GAGTACACCCCTG--ACCTCTCC
S--P--S--Y--S--P--T--S--P--\--K--Y--T--P--T--S--P--S--Y--\--S--P--S--S--P--\--E--Y--T--P--\--T--S--P

----------------------------------------------------------------------------------------------------
--K--Y--S--P--T-----S--P--K--Y--S--P--T--S--P--K--Y--S-----P--T-----S--P--T--Y--S--P--T--T--P--K--Y-
CAAGTACTCACCTACC---AGTCCCAAATATTCACCCACCTCTCCCAAGTACTCG---CCTACC---AGTCCCACCTATTCACCCACCACCCCAAAATAC
:::::::::.::.:::    :.::::::::.::.:: :::::::::::::::::    ::.:::    :.::::::::.::.::::::::::: ::::::
CAAGTACTCGCCCACCA--TGCCCCAAATACTCGCCAACCTCTCCCAAGTACTCTG--CCCACCA--TGCCCCACCTACTCGCCCACCACCCCCAAATAC
--K--Y--S--P--T--\--S--P--K--Y--S--P--T--S--P--K--Y--S--\--P--T--\--S--P--T--Y--S--P--T--T--P--K--Y-

----------------------------------------------------------------------------------------------------
-S--P--T--S--P--T--Y--S--P--T--S--P--V--Y--T--P--T--S--P--K--Y--S--P--T--S--P--T--Y--S--P--T--S--P--
TCCCCAACATCTCCTACTTATTCCCCAACCTCTCCAGTCTACACCCCAACCTCTCCCAAGTACTCACCTACTAGCCCCACTTACTCGCCCACTTCCCCCA
:: :::::.:::::::::::.:: :::::::::::.:::::.:::::::::::.::::::::.:::::.:::::::::::::::::::::::.:::::::
TCGCCAACGTCTCCTACTTACTCACCAACCTCTCCGGTCTATACCCCAACCTCCCCCAAGTATTCACCCACTAGCCCCACTTACTCGCCCACCTCCCCCA
-S--P--T--S--P--T--Y--S--P--T--S--P--V--Y--T--P--T--S--P--K--Y--S--P--T--S--P--T--Y--S--P--T--S--P--

----------------------------------------------------------------------------------------------------
K--Y--S--P--T--S--P--T--Y--S--P--T--S--P--K--G--S--T--Y--S--P--T--S--P--G--Y--S--P--T--S--P--T--Y--S
AGTACTCGCCCACCAGCCCCACCTACTCGCCCACCTCCCCCAAAGGCTCAACCTACTCTCCCACTTCCCCTGGTTACTCGCCCACCAGCCCCACCTACAG
::::::::::::::::::::::::::::.::::: :::::::::::::: :::::::: :::::.::.:::::.:::::::::::::::::::::::.::
AGTACTCGCCCACCAGCCCCACCTACTCACCCACGTCCCCCAAAGGCTCCACCTACTCGCCCACCTCTCCTGGCTACTCGCCCACCAGCCCCACCTATAG
K--Y--S--P--T--S--P--T--Y--S--P--T--S--P--K--G--S--T--Y--S--P--T--S--P--G--Y--S--P--T--S--P--T--Y--S

-------------------------------------------------
--L--T--S--P--A--I--S--P--D--D--S--D--E--E--N--*-
TCTCACAAGCCCGGCTATCAGCCCGGATGACAGTGACGAGGAGAACTGA
.::::: :::::.::.:::::::::::.::::::::.::::::::::::
CCTCACCAGCCCAGCCATCAGCCCGGACGACAGTGATGAGGAGAACTGA
--L--T--S--P--A--I--S--P--D--D--S--D--E--E--N--*-

Pig Consensus Sequence

>BGISUST0000900948
ATGCACGGGGGTGGCCCCCCCTCCGGGGACAGCGCATGCCCGCTGCGCACCATCAAGCGAGTGCAGTTCGGCGTCCTCAGTCCGGATGAACTGAAGCGAA
TGTCCGTGACGGAGGGCGGCATCAAATACCCAGAGACAACCGAGGGAGGCCGCCCCAAGCTGGGGGGGCTGATGGATCCAAGGCAGGGGGTGATCGAG--
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------TACCAGCCCAGGATCCGGCGCTCCGGCCTGGAGCTATATGCC
GAGTGGAAGCACGTCAACGAGGACTCGCAGGAGAAGAAGATCCTGCTGAGTCCCGAGCGGGTGCACGAGATCTTCAAGCGCATCTCGGATGAGGAGTGTT
TCGTCCTGGGCATGGAGCCGCGCTACGCCCGGCCCGAGTGGATGATCGTCACCGTGCTGCCCGTGCCCCCGCTCTCCGTGCGGCCCGCTGTGGTCATGCA
GGGCTCTGCCCGCAACCAGGATGACCTGACGCACAAACTGGCCGACATCGTGAAAATCAACAATCAGCTTCGGCGCAACGAGCAGAACGGCGCGGCGGCC
CACGTCATCGCCGAGGACGTGAAGCTCCTCCAGTTTCACGTGGCCACCATGGTGGACAACGAGCTGCCCGGCCTGCCT---GCCATGCAGAAGTCTGGGC
GTCCTCTCAAGTCCCTGAAGCAGCGGTTGAAGGGCAAGGAAGGCCGCGTGCGGGGGAACCTGATGGGCAAGCGGGTGGACTTCTCGGCCCGCACCGTCAT
CACCCCCGACCCCAACCTCTCCATCGACCAGGTCGGCGTGCCTCGCTCCATCGCCGCCAACATGACCTTCGCAGAGATCGTCACCCCCTTCAACATTGAC
---CTTCAGGAGCTGGTGCGCAGGGGGAACAGCCAGTACCCGGGAGCCAAGTACATCATCCGGGACAACGGCGATCGCATTGACTTGCGTTTCCACCCCA
AGCCCAGTGATCTTCACCTGCAGACTGGCTATAAGGTGGAACGGCACATGTGTGACGGGGACATAGTTATCTTCAACCGGCAGCCAACTTTGCACAAAAT
GTCCATGATGGGACATCGAGTCCGGATCCTCCCNTGGTCTACTTTTCGCTTGAAC---------------------------------------GATGAG
ATGAACTTGCACCTGCCGCAGTCCCTAGAGACACGGGCGGAGATCCAGGAGCTTGCCATGGTGCCACGCATGATTGTCACCCCCCAGAGCAATCGCCCCG
TCATGGGCATTGTGCAGGACACGCTGACTGCAGTGCGCAAATTCACCAAGAGGGACGTCTTCCTGGAGCGG-----------------------------
----------------------------------------AAGCCCCGGCCCCTGTGGACGGGGAAGCAGATCTTCTCCCTCATCATACCCGGCCACATC
AACTGTATCCGCACCCACAGCACCCATCCTGATGACGAGGACAGCGGCCCGTACAAGCACATCTCTCCTGGGGACACCAAGGTGGTGGTGGAGAACGGGG
AGCTGATCATGGGCATCCTGTGTAAGAAGTCTCTGGGCACGTCCGCTGGCTCCCTCGTCCACATCTCTTACCTTGAGATGGGTCACGACATCACTCGCCT
CTTCTATTCCAACATTCAGACCGTCATTAACAACTGGCTCCTCATCGAG---CATACCATTGGCATCGGGGACTCCATTGCTGATTCTAAGACTTACCAA
GACATTCAGAACACTATTAAGAAGGCCAAGCAGGATGTAATAGAGGTCATCGAGAAGGCGCATAACAACGAGCTGGAGCCCACCCCCGGGAACACTCTGC
GGCAGACCTTTGAGAACCAGGTGAACCGCATTCTCAATGATGCCCGAGACAAGACTGGCTCCTCCGCCCAGAAATCCCTGTCTGAATACAACAACTTTAA
GTCTATGGTCGTGTCTGGGGCCAAAGGTTCCAAGATCAACATCTCCCAGGTCATTGCTGTCGTCGGGCAGCAGAATGTGGAGGGCAAGCGGATCCCATTt
gGATTCAAGCACCGGACTCTGCCTCACTTCATCAAGGATGACTATGGGCCCGAGAGCCGTGGCTTTGTGGAgtCCTACCTGGCCGGCCTCACACCCACCG
AGTTCTTCTTCCACGCCATGGGGGGTCGTGAGGGGCTCATCGACACAGCGGTCAAGACT-----------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------TTCCGCTTCGATTATACCAACGAGCGGGCCCTGCGGCGCACGCTGC
AGGAGGACCTGGTGAAGGACGTGCTCAGCAACGCGCACATTCAGAACGAGCTGGAGCGGGAATTCGAGCGGATGCGTGAGGACCGGGAGGTGCTCCGGGT
CATCTTCCCAACGGGTGACAGCAAGGTGGTCCTCCCCTGTAACCTGCTGCGCATGATCTGGAACGCCCAGAAGATCTTC---------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------GCCCATCCCGGAGAGATGGTGGGAGCTCTGGCTGCACAGTCCCTTGGAGAACCCGCCACCCAG
ATGACCTTGAACACCTTCCACTATGCCGGTGTGTCCGCCAAGAACGTGACCCTGGGTGTGCCCCGCCTTAAGGAGCTCATCAACATTTCCAAGAAGCCAA
AGACCCCCTCGCTCACTGTCTTCCTggGCCAGTCTGCTCGAGATGCCGAGAGA-----------------------------------------------
----------------------------------------AGCACAGTGGTGGCAGAGGACCAGGAATGGGTGAATGTGTACTATGAGATGCCCGACTTC
GACGTGGCCCGAATCTCCCCCTGGCTTCTGCGGGTGGAGCTGGACCGGAAGCACATGACTGACCGGAAGCTGACCATGGAGCAGATTGCCGAAAAGATCA
ATGCT---TTCGGTGACGACCTGAATTGCATCTTTAATGACGATAATGCAGAGAAGCTGGTACTCCGTATCCGCATTATGAACAGTGATGAAAACAAGAT
GCAAGAGGAAGAAGAGGTGGTGGACAAGATGGATGCCGACGTCTTCCTGCGCTGCATCGAGTCCAACATGCTGACCGACATGTCCCTGCAGGGGATCGAG
CAGATCAGCAAGGTGTAAATGCACCTGCCGCAGACGGACAACAAGAAGAAGATCATC-------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------CCAACCTCGCCtaGCTACTCCCCCACTTCtcCCAGCTACTCCCCGACCTCGCCt
aGCTACTCCCCTTCGAGCCCACGATACACCCCCCAGTCTCCCACCTATACCCCAAGCTCCCCCAGCTActGCCCCAGCTCCCCCAGCTACAGCCCTACCT
CGCCcaTGTACACCCCAACCAGTCCTTCCTActGCCCCAGCTCGCCggAGTACACCCCtaCCTCTCCCAAGTACTCGCCCACctGCCCCAAATACTCGCC
AACCTCTCCCAAGTACTCtcCCACctGCCCCACCTACTCGCCCACCACCCCCAAATACTCGCCAACGTCTCCTACTTACTCACCAACCTCTCCGGTCTAT
ACCCCAACCTCCCCCAAGTATTCACCCACTAGCCCCACTTACTCGCCCACCTCCCCCAAGTACTCGCCCACCAGCCCCACCTACTCACCCACGTCCCCCA
AAGGCTCCACCTACTCGCCCACCTCTCCTGGCTACTCGCCCACCAGCCCCACCTATAGCCTCACCAGCCCAGCCATCAGCCCGGACGACAGTGATGAGGA
GAACTGA


>BGISUSP0000900948
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIE----------------------------------
--------------------------------------------------------------------------------------YQPRIRRSGLELYA
EWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLP-AMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNID
-LQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRIL-WSTFRLN-------------DE
MNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLER-----------------------KPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIE-HTIGIGDSIADSKTYQ
DIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPF
GFKHRTLPHFIKDDYGPESRGFVESYLAGLTPTEFFFHAMGGREGLIDTAVKT-----------------------------------------------
------------------FRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIF-------
-------------------------------------------------------------------------------AHPGEMVGALAAQSLGEPATQ
MTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLGQSARDAER-----------------------------STVVAEDQEWVNVYYEMPDF
DVARISPWLLRVELDRKHMTDRKLTMEQIAEKINA-FGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDADVFLRCIESNMLTDMSLQGIE
QISKV*MHLPQTDNKKKII---------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------PTSPSYSPTSPSYSPTSP
SYSPSSPRYTPQSPTYTPSSPSYCPSSPSYSPTSPMYTPTSPSYCPSSPEYTPTSPKYSPTCPKYSPTSPKYSPTCPTYSPTTPKYSPTSPTYSPTSPVY
TPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN*