Sequences
EST Library Info
che1Heart - RNA from China
cli2Liver - RNA from China
cly3Lymph - RNA from China
cov4Ovary - RNA from China
cst2Stomach - RNA from China
ecc2Foetus 50 days, cortex cerebri
eje1Foetus 50 days, jejunum
eru1Foetus 50 days, regio umbilicalis
fbs1Unavailable
hlv6Heart, left ventricle
jca1Joint capsule
jej3Small intestine, jejunum
nco1Newborn 115 days, colon
nms1Newborn 115 days, M. semitendinosus
ton1Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000072778 (click for geneview)
Transcript ID ENST00000322910(link to ensembl)
Symbol ACADVL
Localtion Chromosome:17:7063951:7069308:1 band: 17p13.1
Description Acyl-CoA dehydrogenase, very-long-chain specific, mitochondrial precursor (EC 1.3.99.-) (VLCAD). [Source:Uniprot/SWISSPROT;Acc:P49748]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------------------------------------------><-------------------------------------
-M--Q--A--A--R--M--A--A--S--L--G--R--Q--L--L--R--L--G--G--G--S--S--R--L--T--A--L--L--G--Q--P--R--P--
ATGCAGGCGGCTCGGATGGCCGCGAGCTTGGGGCGGCAGCTGCTGAGGCTCGGGGGCGGAAGCTCGCGGCTCACGGCGCTCCTGGGGCAGCCCCGGCCCG
:::::::::::  .::::.:: :::.: ::::::::::::::::::::.: ::::::      ::: :.::: : :::::::.::.::::::::::::::
ATGCAGGCGGCGAAGATGACCCCGAACGTGGGGCGGCAGCTGCTGAGGTTGGGGGGC------TCGAGACTCTCTGCGCTCCCGGAGCAGCCCCGGCCCG
-M--Q--A--A--K--M--T--P--N--V--G--R--Q--L--L--R--L--G--G--------S--R--L--S--A--L--P--E--Q--P--R--P--

-------------------------------------><-------------------------------------------------------------
G--P--A--R--R--P--Y--A--G--G--A--A--Q--L--A--L--D--K--S--D--S--H--P--S--D--A--L--T--R--K--K--P--A--K
GCCCTGCCCGGCGGCCCTATGCCGGGGGTGCCGCTCAGCTGGCTCTGGACAAGTCAGATTCCCACCCCTCTGACGCTCTGACCAGGAAAAAACCGGCCAA
::::::::.:::: ::::::::: . :: :::::.:::                                                              
GCCCTGCCTGGCGTCCCTATGCCCATGGGGCCGCCCAG--------------------------------------------------------------
G--P--A--W--R--P--Y--A--H--G--A--A--Q---------------------------------------------------------------

---><-----------------------------------------------------------------------><----------------------
--A--E--S--K--S--F--A--V--G--M--F--K--G--Q--L--T--T--D--Q--V--F--P--Y--P--S--V--L--N--E--E--Q--T--Q-
GGCGGAATCTAAGTCCTTTGCTGTGGGAATGTTCAAAGGCCAGCTCACCACAGATCAGGTGTTCCCATACCCGTCCGTGCTCAACGAAGAGCAGACACAG
    :::::.::.:::::::::::::: :::::::::::::::::::::::.:::::::::::.:::::.:::                           
----GAATCCAAATCCTTTGCTGTGGGCATGTTCAAAGGCCAGCTCACCACGGATCAGGTGTTTCCATATCCG---------------------------
-----E--S--K--S--F--A--V--G--M--F--K--G--Q--L--T--T--D--Q--V--F--P--Y--P----------------------------

-----------------------------------------><---------------------------------------------------------
-F--L--K--E--L--V--E--P--V--S--R--F--F--E--E--V--N--D--P--A--K--N--D--A--L--E--M--V--E--E--T--T--W--
TTTCTTAAAGAGCTGGTGGAGCCTGTGTCCCGTTTCTTCGAGGAAGTGAACGATCCCGCCAAGAATGACGCTCTGGAGATGGTGGAGGAGACCACTTGGC
                                          ::.:::::::::::.::::::::::::.. ::::::  .:::::::::::::::  ::
------------------------------------------GAGGTGAACGATCCTGCCAAGAATGACATGCTGGAGCGAGTGGAGGAGACCACTATGC
-------------------------------------------E--V--N--D--P--A--K--N--D--M--L--E--R--V--E--E--T--T--M--

----------------------------------------------------------------------------><----------------------
Q--G--L--K--E--L--G--A--F--G--L--Q--V--P--S--E--L--G--G--V--G--L--C--N--T--Q--Y--A--R--L--V--E--I--V
AGGGCCTCAAGGAGCTGGGGGCCTTTGGTCTGCAAGTGCCCAGTGAGCTGGGTGGTGTGGGCCTTTGCAACACCCAGTACGCCCGTTTGGTGGAGATCGT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.::::::::.:::::::::::.:::::::::::.::
AGGGCCTCAAGGAGCTGGGGGCCTTTGGTCTGCAAGTGCCCAGTGAGCTGGGTGGCGTGGGCCTCTGCAACACTCAGTACGCCCGCTTGGTGGAGATTGT
Q--G--L--K--E--L--G--A--F--G--L--Q--V--P--S--E--L--G--G--V--G--L--C--N--T--Q--Y--A--R--L--V--E--I--V

----------------------------------------------------------------------------------------------------
--G--M--H--D--L--G--V--G--I--T--L--G--A--H--Q--S--I--G--F--K--G--I--L--L--F--G--T--K--A--Q--K--E--K-
GGGCATGCATGACCTTGGCGTGGGCATTACCCTGGGGGCCCATCAGAGCATCGGTTTCAAAGGCATCCTGCTCTTTGGCACAAAGGCCCAGAAAGAAAAA
 :: :::::.:::::.:::::::::::...:::::::::::::::::::::.::::::::::::::::::::.::.::::::::::::::::::::::::
CGGAATGCACGACCTCGGCGTGGGCATCGTCCTGGGGGCCCATCAGAGCATTGGTTTCAAAGGCATCCTGCTTTTCGGCACAAAGGCCCAGAAAGAAAAA
--G--M--H--D--L--G--V--G--I--V--L--G--A--H--Q--S--I--G--F--K--G--I--L--L--F--G--T--K--A--Q--K--E--K-

---------------------><-----------------------------------------------------------------------------
-Y--L--P--K--L--A--S--G--E--T--V--A--A--F--C--L--T--E--P--S--S--G--S--D--A--A--S--I--R--T--S--A--V--
TACCTCCCCAAGCTGGCATCTGGGGAGACTGTGGCCGCTTTCTGTCTAACCGAGCCCTCAAGCGGGTCAGATGCAGCCTCCATCCGAACCTCTGCTGTGC
:::::::::::. :::::      :::....::::.:: :::::::::::.:::::::: ::.:::::.::::::::::::::::: : ::: :::::::
TACCTCCCCAAAGTGGCA------GAGGTCATGGCTGCGTTCTGTCTAACTGAGCCCTCCAGTGGGTCGGATGCAGCCTCCATCCGCAGCTCAGCTGTGC
-Y--L--P--K--V--A--------E--V--M--A--A--F--C--L--T--E--P--S--S--G--S--D--A--A--S--I--R--S--S--A--V--

---------------------------------------------------><-----------------------------------------------
P--S--P--C--G--K--Y--Y--T--L--N--G--S--K--L--W--I--S--N--G--G--L--A--D--I--F--T--V--F--A--K--T--P--V
CCAGCCCCTGTGGAAAATACTATACCCTCAATGGAAGCAAGCTTTGGATCAGTAATGGGGGCCTAGCAGACATCTTCACGGTCTTTGCCAAGACACCAGT
::::::::::::::::::::::.::.::::::::::::::: ::::::::   :::::.:::::.:: ::. ::::::::::::::::::::::::::::
CCAGCCCCTGTGGAAAATACTACACTCTCAATGGAAGCAAGATTTGGATC---AATGGAGGCCTGGCCGATCTCTTCACGGTCTTTGCCAAGACACCAGT
P--S--P--C--G--K--Y--Y--T--L--N--G--S--K--I--W--I-----N--G--G--L--A--D--L--F--T--V--F--A--K--T--P--V

-----------------------------------------------------------------------------><---------------------
--T--D--P--A--T--G--A--V--K--E--K--I--T--A--F--V--V--E--R--G--F--G--G--I--T--H--G--P--P--E--K--K--M-
TACAGATCCAGCCACAGGAGCCGTGAAGGAGAAGATCACAGCTTTTGTGGTGGAGAGGGGCTTCGGGGGCATTACCCATGGGCCCCCTGAGAAGAAGATG
::::::.:::::::::::.::::::::::::::::::::::::::. ::::::::::::::::.::.::..:.:::   ::::::::.::::::::::::
TACAGACCCAGCCACAGGGGCCGTGAAGGAGAAGATCACAGCTTTCCTGGTGGAGAGGGGCTTTGGAGGTGTCACC---GGGCCCCCCGAGAAGAAGATG
--T--D--P--A--T--G--A--V--K--E--K--I--T--A--F--L--V--E--R--G--F--G--G--V--T-----G--P--P--E--K--K--M-

----------------------------------------------------------------------------------------------------
-G--I--K--A--S--N--T--A--E--V--F--F--D--G--V--R--V--P--S--E--N--V--L--G--E--V--G--S--G--F--K--V--A--
GGCATCAAGGCTTCAAACACAGCAGAGGTGTTCTTTGATGGAGTACGGGTGCCATCGGAGAACGTGCTGGGTGAGGTTGGGAGTGGCTTCAAGGTTGCCA
:::::::::::.::::::::.::.::::::: ::::::.:.:::.:..:::::  :.::::::::::::::.:::::.:::.:.:::::::::::.::::
GGCATCAAGGCCTCAAACACGGCGGAGGTGTACTTTGACGAAGTGCAAGTGCCCACAGAGAACGTGCTGGGCGAGGTCGGGGGCGGCTTCAAGGTCGCCA
-G--I--K--A--S--N--T--A--E--V--Y--F--D--E--V--Q--V--P--T--E--N--V--L--G--E--V--G--G--G--F--K--V--A--

----------------------------------------------------------------------------><----------------------
M--H--I--L--N--N--G--R--F--G--M--A--A--A--L--A--G--T--M--R--G--I--I--A--K--A--V--D--H--A--T--N--R--T
TGCACATCCTCAACAATGGAAGGTTTGGCATGGCTGCGGCCCTGGCAGGTACCATGAGAGGCATCATTGCTAAGGCGGTAGATCATGCCACTAATCGTAC
:::::::.::::::::::::::::::::::::::.:::::: :::: ::.:::::::..: :::::::::.::::::::..:::::::..::::::::::
TGCACATTCTCAACAATGGAAGGTTTGGCATGGCCGCGGCCATGGCCGGCACCATGAAGGCCATCATTGCCAAGGCGGTGAATCATGCTGCTAATCGTAC
M--H--I--L--N--N--G--R--F--G--M--A--A--A--M--A--G--T--M--K--A--I--I--A--K--A--V--N--H--A--A--N--R--T

---------------------------------------------------------------------------------><-----------------
--Q--F--G--E--K--I--H--N--F--G--L--I--Q--E--K--L--A--R--M--V--M--L--Q--Y--V--T--E--S--M--A--Y--M--V-
CCAGTTTGGGGAGAAAATTCACAACTTTGGGCTGATCCAGGAGAAGCTGGCACGGATGGTTATGCTGCAGTATGTAACTGAGTCCATGGCTTACATGGTG
::::::.:::::::::::::::::::::::: :::::::::::::::: :: :::::::.:::::::::::::::.::::::::::::::.:::::::::
CCAGTTCGGGGAGAAAATTCACAACTTTGGGGTGATCCAGGAGAAGCTTGCCCGGATGGCTATGCTGCAGTATGTGACTGAGTCCATGGCCTACATGGTG
--Q--F--G--E--K--I--H--N--F--G--V--I--Q--E--K--L--A--R--M--A--M--L--Q--Y--V--T--E--S--M--A--Y--M--V-

--------------------------------------------------------------------><------------------------------
-S--A--N--M--D--Q--G--A--T--D--F--Q--I--E--A--A--I--S--K--I--F--G--S--E--A--A--W--K--V--T--D--E--C--
AGTGCTAACATGGACCAGGGAGCCACGGACTTCCAGATAGAGGCCGCCATCAGCAAAATCTTTGGCTCGGAGGCAGCCTGGAAGGTGACAGATGAATGCA
::.::.::::::::::::::: ::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.::::
AGCGCCAACATGGACCAGGGATCCACGGACTTCCAGATAGAGGCCGCCATCAGCAAGATCTTTGGCTCGGAGGCAGCCTGGAAGGTGACAGATGAGTGCA
-S--A--N--M--D--Q--G--S--T--D--F--Q--I--E--A--A--I--S--K--I--F--G--S--E--A--A--W--K--V--T--D--E--C--

-------------------------------><-------------------------------------------------------------------
I--Q--I--M--G--G--M--G--F--M--K--E--P--G--V--E--R--V--L--R--D--L--R--I--F--R--I--F--E--G--T--N--D--I
TCCAAATCATGGGGGGTATGGGCTTCATGAAGGAACCTGGAGTAGAGCGTGTGCTCCGAGATCTTCGCATCTTCCGGATCTTTGAGGGGACAAATGACAT
:::::.::::::::::.:::::::::::::::::.::.::.::::::::::::::::::::.:: :::::::: ::::::::::::::::: ::::::::
TCCAAGTCATGGGGGGCATGGGCTTCATGAAGGAGCCCGGGGTAGAGCGTGTGCTCCGAGACCTGCGCATCTTACGGATCTTTGAGGGGACCAATGACAT
I--Q--V--M--G--G--M--G--F--M--K--E--P--G--V--E--R--V--L--R--D--L--R--I--L--R--I--F--E--G--T--N--D--I

---------------------------------><-----------------------------------------------------------------
--L--R--L--F--V--A--L--Q--G--C--M--D--K--G--K--E--L--S--G--L--G--S--A--L--K--N--P--F--G--N--A--G--L-
TCTTCGGCTGTTTGTGGCTCTGCAGGGCTGTATGGACAAAGGAAAGGAGCTCTCTGGGCTTGGCAGTGCTCTAAAGAATCCCTTTGGGAATGCTGGCCTC
:::.::::: ::::::::::::::.:::.:::::                                                                  
TCTCCGGCTCTTTGTGGCTCTGCAAGGCCGTATG------------------------------------------------------------------
--L--R--L--F--V--A--L--Q--G--R--M-------------------------------------------------------------------

-------------------------------><-------------------------------------------------------------------
-L--L--G--E--A--G--K--Q--L--R--R--R--A--G--L--G--S--G--L--S--L--S--G--L--V--H--P--E--L--S--R--S--G--
CTGCTAGGAGAGGCAGGCAAACAGCTGAGGCGGCGGGCAGGGCTGGGCAGCGGCCTGAGTCTCAGCGGACTTGTCCACCCGGAGTTGAGTCGGAGTGGCG
                                 :::::::::::::::::.:::::::::::::::::  :..:::::::.::..::::::::::.::: 
---------------------------------CGGGCAGGGCTGGGCAGTGGCCTGAGTCTCAGCGGCATCATCCACCCAGAACTGAGTCGGAGCGGCC
----------------------------------R--A--G--L--G--S--G--L--S--L--S--G--I--I--H--P--E--L--S--R--S--G--

----><-----------------------------------------------------------------------><---------------------
E--L--A--V--R--A--L--E--Q--F--A--T--V--V--E--A--K--L--I--K--H--K--K--G--I--V--N--E--Q--F--L--L--Q--R
AGCTGGCAGTACGGGCTCTGGAGCAGTTTGCCACTGTGGTGGAGGCCAAGCTGATAAAACACAAGAAGGGGATTGTCAATGAACAGTTTCTGCTGCAGCG
::::::::::.:.:::::::::::::::::::::.::::::::::. ::::::::::::::::::::::. ::::::   ::::::::. ::::::::::
AGCTGGCAGTGCAGGCTCTGGAGCAGTTTGCCACCGTGGTGGAGGTGAAGCTGATAAAACACAAGAAGGATATTGTC---GAACAGTTCGTGCTGCAGCG
Q--L--A--V--Q--A--L--E--Q--F--A--T--V--V--E--V--K--L--I--K--H--K--K--D--I--V-----E--Q--F--V--L--Q--R

--------------------------------------------------><------------------------------------------------
--L--A--D--G--A--I--D--L--Y--A--M--V--V--V--L--S--R--A--S--R--S--L--S--E--G--H--P--T--A--Q--H--E--K-
GCTGGCAGACGGGGCCATCGACCTCTATGCCATGGTGGTGGTTCTCTCGAGGGCCTCAAGATCCCTGAGTGAGGGCCACCCCACGGCCCAGCATGAGAAA
 ::::::::..: :::::.::::::::.:::::::::::::::::       ::::: ::.::::::::::::::::: .::::.::::::::.::::::
CCTGGCAGATAGTGCCATTGACCTCTACGCCATGGTGGTGGTTCTG------GCCTCCAGGTCCCTGAGTGAGGGCCAGTCCACAGCCCAGCACGAGAAA
--L--A--D--S--A--I--D--L--Y--A--M--V--V--V--L--------A--S--R--S--L--S--E--G--Q--S--T--A--Q--H--E--K-

--------------------------><------------------------------------------------------------------------
-M--L--C--D--T--W--C--I--E--A--A--A--R--I--R--E--G--M--A--A--L--Q--S--D--P--W--Q--Q--E--L--Y--R--N--
ATGCTCTGTGACACCTGGTGTATCGAGGCTGCAGCTCGGATCCGAGAGGGCATGGCCGCCCTGCAGTCTGACCCCTGGCAGCAAGAGCTCTACCGCAACT
::::::::.:::: ::::::.::::::::::::::.::::::::.:::..::::::.::.:::::::::::::: ..::::::.::::::: :::.::::
ATGCTCTGCGACAGCTGGTGCATCGAGGCTGCAGCCCGGATCCGGGAGAACATGGCTGCTCTGCAGTCTGACCCGCAGCAGCAGGAGCTCTTCCGTAACT
-M--L--C--D--S--W--C--I--E--A--A--A--R--I--R--E--N--M--A--A--L--Q--S--D--P--Q--Q--Q--E--L--F--R--N--

------------------------------------------------------------------->
F--K--S--I--S--K--A--L--V--E--R--G--G--V--V--T--S--N--P--L--G--F--*-
TCAAAAGCATCTCCAAGGCCTTGGTGGAGCGGGGTGGTGTGGTCACCAGCAACCCACTTGGCTTCTGA
:::::::::::::::::::::::.:.:::::::::::.::::::::::::::::: :::::: :::::
TCAAAAGCATCTCCAAGGCCTTGATAGAGCGGGGTGGCGTGGTCACCAGCAACCCCCTTGGCGTCTGA
F--K--S--I--S--K--A--L--I--E--R--G--G--V--V--T--S--N--P--L--G--V--*-

Pig Consensus Sequence

>BGISUST0000888759
ATGCAGGCGGCGAAGATGACCCCGAACGTGGGGCGGCAGCTGCTGAGGTTGGGGGGC------TCGAGACTCTCTGCGCTCCCGGAGCAGCCCCGGCCCG
GCCCTGCCTGGCGTCCCTATGCCCATGGGGCCGCCCAG--------------------------------------------------------------
----GAATCCAAATCCTTTGCTGTGGGCATGTTCAAAGGCCAGCTCACCACGGATCAGGTGTTTCCATATCCG---------------------------
------------------------------------------GAGGTGAACGATCCTGCCAAGAATGACATGCTGGAGCGAGTGGAGGAGACCACTATGC
AGGGCCTCAAGGAGCTGGGGGCCTTTGGTCTGCAAGTGCCCAGTGAGCTGGGTGGCGTGGGCCTCTGCAACACTCAGTACGCCCGCTTGGTGGAGATTGT
CGGAATGCACGACCTCGGCGTGGGCATCGTCCTGGGGGCCCATCAGAGCATTGGTTTCAAAGGCATCCTGCTTTTCGGCACAAAGGCCCAGAAAGAAAAA
TACCTCCCCAAAGTGGCA------GAGGTCATGGCTGCGTTCTGTCTAACTGAGCCCTCCAGTGGGTCGGATGCAGCCTCCATCCGCAGCTCAGCTGTGC
CCAGCCCCTGTGGAAAATACTACACTCTCAATGGAAGCAAGATTTGGATC---AATGGAGGCCTGGCCGATCTCTTCACGGTCTTTGCCAAGACACCAGT
TACAGACCCAGCCACAGGGGCCGTGAAGGAGAAGATCACAGCTTTCCTGGTGGAGAGGGGCTTTGGAGGTGTCACC---GGGCCCCCCGAGAAGAAGATG
GGCATCAAGGCCTCAAACACGGCGGAGGTGTACTTTGACGAAGTGCAAGTGCCCACAGAGAACGTGCTGGGCGAGGTCGGGGGCGGCTTCAAGGTCGCCA
TGCACATTCTCAACAATGGAAGGTTTGGCATGGCCGCGGCCATGGCCGGCACCATGAAGGCCATCATTGCCAAGGCGGTGAATCATGCTGCTAATCGTAC
CCAGTTCGGGGAGAAAATTCACAACTTTGGGGTGATCCAGGAGAAGCTTGCCCGGATGGCTATGCTGCAGTATGTGACTGAGTCCATGGCCTACATGGTG
AGCGCCAACATGGACCAGGGATCCACGGACTTCCAGATAGAGGCCGCCATCAGCAAGATCTTTGGCTCGGAGGCAGCCTGGAAGGTGACAGATGAGTGCA
TCCAAGTCATGGGGGGCATGGGCTTCATGAAGGAGCCCGGGGTAGAGCGTGTGCTCCGAGACCTGCGCATCTTACGGATCTTTGAGGGGACCAATGACAT
TCTCCGGCTCTTTGTGGCTCTGCAAGGCCGTATG------------------------------------------------------------------
---------------------------------CGGGCAGGGCTGGGCAGTGGCCTGAGTCTCAGCGGCATCATCCACCCAGAACTGAGTCGGAGCGGCC
AGCTGGCAGTGCAGGCTCTGGAGCAGTTTGCCACCGTGGTGGAGGTGAAGCTGATAAAACACAAGAAGGATATTGTC---GAACAGTTCGTGCTGCAGCG
CCTGGCAGATAGTGCCATTGACCTCTACGCCATGGTGGTGGTTCTG------GCCTCCAGGTCCCTGAGTGAGGGCCAGTCCACAGCCCAGCACGAGAAA
ATGCTCTGCGACAGCTGGTGCATCGAGGCTGCAGCCCGGATCCGGGAGAACATGGCTGCTCTGCAGTCTGACCCGCAGCAGCAGGAGCTCTTCCGTAACT
TCAAAAGCATCTCCAAGGCCTTGATAGAGCGGGGTGGCGTGGTCACCAGCAACCCCCTTGGCGTCTGA


>BGISUSP0000888759
MQAAKMTPNVGRQLLRLGG--SRLSALPEQPRPGPAWRPYAHGAAQ----------------------ESKSFAVGMFKGQLTTDQVFPYP---------
--------------EVNDPAKNDMLERVEETTMQGLKELGAFGLQVPSELGGVGLCNTQYARLVEIVGMHDLGVGIVLGAHQSIGFKGILLFGTKAQKEK
YLPKVA--EVMAAFCLTEPSSGSDAASIRSSAVPSPCGKYYTLNGSKIWI-NGGLADLFTVFAKTPVTDPATGAVKEKITAFLVERGFGGVT-GPPEKKM
GIKASNTAEVYFDEVQVPTENVLGEVGGGFKVAMHILNNGRFGMAAAMAGTMKAIIAKAVNHAANRTQFGEKIHNFGVIQEKLARMAMLQYVTESMAYMV
SANMDQGSTDFQIEAAISKIFGSEAAWKVTDECIQVMGGMGFMKEPGVERVLRDLRILRIFEGTNDILRLFVALQGRM----------------------
-----------RAGLGSGLSLSGIIHPELSRSGQLAVQALEQFATVVEVKLIKHKKDIV-EQFVLQRLADSAIDLYAMVVVL--ASRSLSEGQSTAQHEK
MLCDSWCIEAAARIRENMAALQSDPQQQELFRNFKSISKALIERGGVVTSNPLGV*