Sequences
EST Library Info
med1Mediastinum
Clusters
Oligos
SNPs

Gene ID ENSG00000103495 (click for geneview)
Transcript ID ENST00000322945(link to ensembl)
Symbol MAZ
Localtion Chromosome:16:29725460:29729206:1 band: 16p11.2
Description Myc-associated zinc finger protein (MAZI) (Purine-binding transcription factor) (Pur-1) (ZF87) (ZIF87). [Source:Uniprot/SWISSPROT;Acc:P56270]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------><---------------------------------------------
-G--P--A--R--P--A--P--P--A--P--A--E--P--R--G--P--R--C--E--A--M--F--P--V--F--P--C--T--L--L--A--P--P--
GGCCCCGCGCGGCCCGCGCCCCCGGCCCCCGCTGAGCCCCGGGGGCCCCGCTGCGAGGCCATGTTCCCGGTGTTTCCTTGCACGCTGCTGGCCCCCCCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--P--V--L--G--L--D--S--R--G--V--G--G--L--M--N--S--F--P--P--P--Q--G--H--A--Q--N--P--L--Q--V--G--A--E
TCCCCGTGCTGGGCCTGGACTCCCGGGGGGTGGGCGGCCTCATGAACTCCTTCCCGCCACCTCAGGGTCACGCCCAGAACCCCCTGCAGGTCGGGGCTGA
           :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
-----------GGCCTGGACTCCCGGGGGGTGGGCGGCCTCATGAACTCCTTCCCGCCACCTCAGGGTCACGCCCAGAACCCCCTGCAGGTCGGGGCTGA
------------G--L--D--S--R--G--V--G--G--L--M--N--S--F--P--P--P--Q--G--H--A--Q--N--P--L--Q--V--G--A--E

---------------------------------------------------><-----------------------------------------------
--L--Q--S--R--F--F--A--S--Q--G--C--A--Q--S--P--F--Q--A--A--P--A--P--P--P--T--P--Q--A--P--A--A--E--P-
GCTCCAGTCCCGCTTCTTTGCCTCCCAGGGCTGCGCCCAGAGTCCATTCCAGGCCGCGCCGGCGCCCCCGCCCACGCCCCAGGCCCCGGCGGCCGAGCCC
::::::::::::::::::::::::::::::::::::::::::::::::::::                                                
GCTCCAGTCCCGCTTCTTTGCCTCCCAGGGCTGCGCCCAGAGTCCATTCCAG------------------------------------------------
--L--Q--S--R--F--F--A--S--Q--G--C--A--Q--S--P--F--Q-------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--Q--V--D--L--L--P--V--L--A--A--A--Q--E--S--A--A--A--A--A--A--A--A--A--A--A--A--A--V--A--A--A--P--
CTCCAGGTGGACTTGCTCCCGGTGCTCGCCGCCGCCCAGGAGTCCGCCGCGGCTGCTGCGGCCGCTGCCGCCGCTGCTGCCGCCGTCGCTGCCGCGCCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--A--P--A--A--A--S--T--V--D--T--A--A--L--K--Q--P--P--A--P--P--P--P--P--P--P--V--S--A--P--A--A--E--A
CGGCCCCTGCCGCCGCCTCTACGGTGGACACAGCGGCCCTGAAGCAGCCTCCGGCGCCCCCTCCGCCACCCCCGCCAGTGTCGGCGCCCGCGGCCGAGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--P--P--A--S--A--A--T--I--A--A--A--A--A--T--A--V--V--A--P--T--S--T--V--A--V--A--P--V--A--S--A--L-
CGCGCCCCCCGCCTCCGCCGCCACTATCGCCGCGGCGGCGGCCACCGCCGTCGTAGCCCCAACCTCGACGGTCGCCGTGGCCCCGGTCGCGTCTGCCTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--K--K--T--K--S--K--G--P--Y--I--C--A--L--C--A--K--E--F--K--N--G--Y--N--L--R--R--H--E--A--I--H--T--
GAGAAGAAGACAAAGAGCAAGGGGCCCTACATCTGCGCTCTGTGCGCCAAGGAGTTCAAGAACGGCTACAATCTCCGGAGGCACGAAGCCATCCACACGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--A--K--A--G--R--V--P--S--G--A--M--K--M--P--T--M--V--P--L--S--L--L--S--V--P--Q--L--S--G--A--G--G--G
GAGCCAAGGCCGGCCGGGTCCCCTCGGGTGCTATGAAGATGCCGACCATGGTGCCCCTGAGCCTCCTGAGCGTGCCCCAGCTGAGCGGAGCCGGCGGGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--G--E--A--G--A--G--G--G--A--A--A--V--A--A--G--G--V--V--T--T--T--A--S--G--K--R--I--R--K--N--H--A-
AGGGGGAGAGGCGGGTGCCGGCGGCGGCGCTGCCGCAGTGGCCGCCGGTGGCGTGGTGACCACGACCGCCTCGGGGAAGCGCATCCGGAAGAACCATGCC
                            :: :::::::::::::::::.:::::::: :::::::::::::::::.::::::::::::::::::::.:::
----------------------------GCGGCCGCAGTGGCCGCCGGCGGCGTGGTCACCACGACCGCCTCGGGAAAGCGCATCCGGAAGAACCACGCC
-----------------------------A--A--A--V--A--A--G--G--V--V--T--T--T--A--S--G--K--R--I--R--K--N--H--A-

----------------------------------------------------------------------------------------------------
-C--E--M--C--G--K--A--F--R--D--V--Y--H--L--N--R--H--K--L--S--H--S--D--E--K--P--Y--Q--C--P--V--C--Q--
TGCGAGATGTGTGGCAAGGCCTTCCGCGACGTCTACCACCTGAACCGACACAAGCTGTCGCACTCGGACGAGAAGCCCTACCAGTGCCCGGTGTGCCAGC
:::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGCGAGATGTGCGGCAAGGCCTTCCGCGACGTCTACCACCTGAACCGACACAAGCTGTCGCACTCGGACGAGAAGCCCTACCAGTGCCCGGTGTGCCAGC
-C--E--M--C--G--K--A--F--R--D--V--Y--H--L--N--R--H--K--L--S--H--S--D--E--K--P--Y--Q--C--P--V--C--Q--

----------------------------------------------------------------------------------------------------
Q--R--F--K--R--K--D--R--M--S--Y--H--V--R--S--H--D--G--A--V--H--K--P--Y--N--C--S--H--C--G--K--S--F--S
AGCGCTTCAAGCGCAAGGACCGCATGAGCTACCACGTGCGCTCACATGACGGCGCTGTGCACAAGCCCTACAACTGCTCCCACTGTGGCAAGAGCTTCTC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AGCGCTTCAAGCGCAAGGACCGCATGAGCTACCACGTGCGCTCACATGACGGCGCTGTGCACAAGCCCTACAACTGCTCCCACTGTGGCAAGAGCTTCTC
Q--R--F--K--R--K--D--R--M--S--Y--H--V--R--S--H--D--G--A--V--H--K--P--Y--N--C--S--H--C--G--K--S--F--S

--><--------------------------------------------------------------><--------------------------------
--R--P--D--H--L--N--S--H--V--R--Q--V--H--S--T--E--R--P--F--K--C--E--K--C--E--A--A--F--A--T--K--D--R-
CCGGCCGGATCACCTCAACAGTCACGTCAGACAAGTGCACTCAACAGAACGGCCCTTCAAATGTGAGAAATGTGAGGCAGCTTTCGCCACGAAGGATCGG
:   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.::::::::::::
C---CCGGATCACCTCAACAGTCACGTCAGACAAGTGCACTCAACAGAACGGCCCTTCAAATGTGAGAAATGTGAGGCAGCTTTTGCTACGAAGGATCGG
-----P--D--H--L--N--S--H--V--R--Q--V--H--S--T--E--R--P--F--K--C--E--K--C--E--A--A--F--A--T--K--D--R-

----------------------------------------------------------------------------------------------------
-L--R--A--H--T--V--R--H--E--E--K--V--P--C--H--V--C--G--K--M--L--S--S--A--Y--I--S--D--H--M--K--V--H--
CTGCGGGCGCACACAGTACGACACGAGGAGAAAGTGCCATGTCACGTGTGTGGCAAGATGCTGAGCTCGGCTTATATTTCGGACCACATGAAGGTGCACA
:::::::: :::::::::::::::::::::::.:::::::::::.:::::::::::::::.:::::::::::::::::::::::::::::::::: ::::
CTGCGGGCCCACACAGTACGACACGAGGAGAAGGTGCCATGTCATGTGTGTGGCAAGATGTTGAGCTCGGCTTATATTTCGGACCACATGAAGGTTCACA
-L--R--A--H--T--V--R--H--E--E--K--V--P--C--H--V--C--G--K--M--L--S--S--A--Y--I--S--D--H--M--K--V--H--

--------------------------------------><------------------------------------------------------------
S--Q--G--P--H--H--V--C--E--L--C--N--K--G--T--G--E--V--C--P--M--A--A--A--A--A--A--A--A--A--A--A--A--A
GCCAGGGTCCTCACCATGTCTGTGAGCTCTGCAACAAAGGTACTGGTGAGGTTTGTCCAATGGCGGCGGCAGCGGCAGCGGCGGCAGCGGCAGCAGCGGC
:::::::.::::::::::::::::::::::::::::::   :: ::::::::.:::::::::::::::::.::::::::.:::::.::.::.::::::::
GCCAGGGCCCTCACCATGTCTGTGAGCTCTGCAACAAA---ACAGGTGAGGTCTGTCCAATGGCGGCGGCGGCGGCAGCAGCGGCGGCAGCGGCAGCGGC
S--Q--G--P--H--H--V--C--E--L--C--N--K-----T--G--E--V--C--P--M--A--A--A--A--A--A--A--A--A--A--A--A--A

--------------------------------------------------------------------------------------------->
--A--V--A--A--P--P--T--A--V--G--S--L--S--G--A--E--G--V--P--V--S--S--Q--P--L--P--S--Q--P--W--*-
AGCAGTAGCAGCCCCTCCCACAGCTGTGGGCTCCCTCTCGGGGGCGGAGGGGGTGCCTGTGAGCTCTCAGCCACTTCCCTCCCAACCCTGGTGA
::::::.:::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::.:::::::::
AGCAGTGGCAGCCCCTCCCACAGCTGTGGGCTCCCTCTCGGGGGCCGAGGGGGTGCCTGTGAGCTCTCAGCCACTTCCCTCCCAGCCCTGGTGA
--A--V--A--A--P--P--T--A--V--G--S--L--S--G--A--E--G--V--P--V--S--S--Q--P--L--P--S--Q--P--W--*-

Pig Consensus Sequence

>BGISUST0000896957
----------------------------------------------------------------------------------------------------
-----------GGCCTGGACTCCCGGGGGGTGGGCGGCCTCATGAACTCCTTCCCGCCACCTCAGGGTCACGCCCAGAACCCCCTGCAGGTCGGGGCTGA
GCTCCAGTCCCGCTTCTTTGCCTCCCAGGGCTGCGCCCAGAGTCCATTCCAG------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------GCGGCCGCAGTGGCCGCCGGCGGCGTGGTCACCACGACCGCCTCGGGAAAGCGCATCCGGAAGAACCACGCC
TGCGAGATGTGCGGCAAGGCCTTCCGCGACGTCTACCACCTGAACCGACACAAGCTGTCGCACTCGGACGAGAAGCCCTACCAGTGCCCGGTGTGCCAGC
AGCGCTTCAAGCGCAAGGACCGCATGAGCTACCACGTGCGCTCACATGACGGCGCTGTGCACAAGCCCTACAACTGCTCCCACTGTGGCAAGAGCTTCTC
C---CCGGATCACCTCAACAGTCACGTCAGACAAGTGCACTCAACAGAACGGCCCTTCAAATGTGAGAAATGTGAGGCAGCTTTTGCTACGAAGGATCGG
CTGCGGGCCCACACAGTACGACACGAGGAGAAGGTGCCATGTCATGTGTGTGGCAAGATGTTGAGCTCGGCTTATATTTCGGACCACATGAAGGTTCACA
GCCAGGGCCCTCACCATGTCTGTGAGCTCTGCAACAAA---ACAGGTGAGGTCTGTCCAATGGCGGCGGCGGCGGCAGCAGCGGCGGCAGCGGCAGCGGC
AGCAGTGGCAGCCCCTCCCACAGCTGTGGGCTCCCTCTCGGGGGCCGAGGGGGTGCCTGTGAGCTCTCAGCCACTTCCCTCCCAGCCCTGGTGA


>BGISUSP0000896957
-------------------------------------GLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQ----------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------AAAVAAGGVVTTTASGKRIRKNHA
CEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFS-PDHLNSHVRQVHSTERPFKCEKCEAAFATKDR
LRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNK-TGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW*