Sequences
EST Library Info
plac1Unavailable
spl2Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000180233 (click for geneview)
Transcript ID ENST00000323037(link to ensembl)
Symbol ZNRF2
Localtion Chromosome:7:30097163:30180547:1 band: 7p15.1
Description zinc finger/RING finger 2 [Source:RefSeq_peptide;Acc:NP_667339]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--A--K--Q--S--G--P--A--A--A--N--G--R--T--R--A--Y--S--G--S--D--L--P--S--S--S--S--------G--G--A--
ATGGGCGCCAAACAGAGCGGCCCGGCCGCCGCTAACGGCCGCACGCGCGCGTACTCGGGCTCGGATCTACCTTCCAGTAGCAGC------GGAGGCGCCA
                                                ::::::::::::::::::.::::::::::.::::::      ::::: ::::
------------------------------------------------GCGTACTCGGGCTCGGATTTACCTTCCAGCAGCAGCAGCAGCGGAGGGGCCA
-------------------------------------------------A--Y--S--G--S--D--L--P--S--S--S--S--S--S--G--G--A--

----------------------------------------------------------------------------------------------------
N--G--T--A--G--G--G--G--G--A--R--A--A--A--A--G--R--F--P--A--Q--V--P--S--A--H--Q--P--S--A--S--G--G--A
ATGGGACCGCGGGCGGCGGCGGGGGCGCTCGGGCCGCCGCCGCGGGGAGGTTCCCGGCTCAGGTGCCCAGCGCGCACCAGCCCAGCGCCTCCGGCGGCGC
:.::::::::.      :::.: :: :: :::::::: ::::: :::::.:: :::::::::::::::.:::::::::::::.:::::::::::::::::
ACGGGACCGCA------GGCAGCGGGGCGCGGGCCGCGGCCGCCGGGAGATTGCCGGCTCAGGTGCCCGGCGCGCACCAGCCTAGCGCCTCCGGCGGCGC
N--G--T--A--------G--S--G--A--R--A--A--A--A--G--R--L--P--A--Q--V--P--G--A--H--Q--P--S--A--S--G--G--A

----------------------------------------------------------------------------------------------------
--A--A--A--A--A--A--P--A--A--P--A--A--P--R--S--R--S--L--G--G--A--V--G--S--V--A--S--G--A--R--A--A--Q-
CGCGGCGGCCGCGGCGGCCCCGGCAGCCCCGGCGGCCCCGCGCAGCCGCTCCCTCGGCGGGGCCGTGGGGAGCGTGGCGTCGGGGGCCCGCGCGGCGCAG
:::::::::: ::                  :::::::::::::::::::::::::::::::: :::::.: ::::::::::::::::::::::::::::
CGCGGCGGCCTCG------------------GCGGCCCCGCGCAGCCGCTCCCTCGGCGGGGCGGTGGGAACCGTGGCGTCGGGGGCCCGCGCGGCGCAG
--A--A--A--S--------------------A--A--P--R--S--R--S--L--G--G--A--V--G--T--V--A--S--G--A--R--A--A--Q-

----------------------------------------------------------------------------------------------------
-S--P--F--S--I--P--N--S--S--S--G--P--Y--G--S--Q--D--S--V--H--S--S--P--E--D--G--G--G--G--------------
TCCCCCTTCAGCATCCCGAACAGCAGCAGCGGCCCGTACGGCTCGCAGGACTCGGTGCACAGCAGCCCTGAGGACGGCGGCGGCGGC-------------
::: ::::::::::::: ::.::::::::::::::::::::::::::::::::::: ::::::::::: ::::::::::::::::::             
TCCACCTTCAGCATCCCCAATAGCAGCAGCGGCCCGTACGGCTCGCAGGACTCGGTTCACAGCAGCCCGGAGGACGGCGGCGGCGGCGGCAGCGGCGGCG
-S--T--F--S--I--P--N--S--S--S--G--P--Y--G--S--Q--D--S--V--H--S--S--P--E--D--G--G--G--G--G--S--G--G--

-----------------------------------------------------------------------------------------><---------
---R--D--R--P--V--G--G--S--P--G--G--P--R--L--V--I--G--S--L--P--A--H--L--S--P--H--M--F--G--G--F--K--C
--CGGGACCGGCCGGTGGGCGGGAGCCCCGGCGGGCCGCGCCTGGTGATCGGCTCCTTACCAGCTCACCTCTCGCCGCACATGTTTGGAGGATTTAAGTG
   ::::::::::::.:::::::.:::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::           
GCAGGGACCGGCCGGCGGGCGGGGGCCCCGGCGGGCCGCGCCTGGTGATCGGCTCTTTACCAGCTCACCTCTCGCCGCACATGTTTGGA-----------
G--R--D--R--P--A--G--G--G--P--G--G--P--R--L--V--I--G--S--L--P--A--H--L--S--P--H--M--F--G------------

----------------------------------------------------------------------------------------><----------
--P--V--C--S--K--F--V--S--S--D--E--M--D--L-----H--L--V--M--C--L--T--K--P--R--I--T--Y--N--E--D--V--L-
CCCTGTATGCTCAAAATTTGTATCCTCAGATGAAATGGATTTG---CATCTTGTAATGTGTTTAACAAAGCCACGAATAACCTATAATGAGGATGTACTG
 :: ::::::::::::::::::.::::::::::::::::::::    .::::::.:::::::::::::::::: ::::::::::::::   :::::::::
-CCAGTATGCTCAAAATTTGTACCCTCAGATGAAATGGATTTGC--AGTCTTGTGATGTGTTTAACAAAGCCAAGAATAACCTATAAT---GATGTACTG
--P--V--C--S--K--F--V--P--S--D--E--M--D--L--\--H--L--V--M--C--L--T--K--P--R--I--T--Y--N-----D--V--L-

----------------------------------------------------------------------------------------------><----
-S--K--D--A--G--E--C--A--I--C--L--E--E--L--Q--Q--G--D--T--I--A--R--L--P--C--L--C--I--Y--H--K--G--C--
AGTAAAGATGCTGGGGAATGTGCAATATGCCTTGAAGAATTGCAGCAGGGAGATACTATAGCACGACTGCCTTGTCTATGCATATATCATAAAGGCTGCA
::::::::::::::::::::: ::::::::::::::::.::::::::::::::::: ::::::::::::::::::::::::::::::::::::   ::::
AGTAAAGATGCTGGGGAATGTTCAATATGCCTTGAAGAGTTGCAGCAGGGAGATACGATAGCACGACTGCCTTGTCTATGCATATATCATAAA---TGCA
-S--K--D--A--G--E--C--S--I--C--L--E--E--L--Q--Q--G--D--T--I--A--R--L--P--C--L--C--I--Y--H--K-----C--

---------------------------------------------------->
I--D--E--W--F--E--V--N--R--S--C--P--E--H--P--S--D--*-
TAGATGAATGGTTTGAAGTAAATAGATCTTGCCCTGAGCACCCTTCAGATTAA
:::::::::::::::::::::::::::::::::::::::::::::::::::::
TAGATGAATGGTTTGAAGTAAATAGATCTTGCCCTGAGCACCCTTCAGATTAA
I--D--E--W--F--E--V--N--R--S--C--P--E--H--P--S--D--*-

Pig Consensus Sequence

>BGISUST0000880792
------------------------------------------------GCGTACTCGGGCTCGGATTTACCTTCCAGCAGCAGCAGCAGCGGAGGGGCCA
ACGGGACCGCAGGCAGCGGGGCGCGGGCCGCGGCCGCCGGGAGATTGCCGGCTCAGGTGCCCGGCGCGCACCAGCCTAGCGCCTCCGGCGGCGCCGCGGC
GGCCTCGGCGGCCCCGCGCAGCCGCTCCCTCGGCGGGGCGGTGGGAACCGTGGCGTCGGGGGCCCGCGCGGCGCAGTCCACCTTCAGCATCCCCAATAGC
AGCAGCGGCCCGTACGGCTCGCAGGACTCGGTTCACAGCAGCCCGGAGGACGGCGGCGGCGGCGGCAGCGGCGGCGGCAGGGACCGGCCGGCGGGCGGGG
GCCCCGGCGGGCCGCGCCTGGTGATCGGCTCTTTACCAGCTCAC------------CCAGTATGCTCAAAATTTGTACCCTCAGATGAAATGGATTTgaG
TCTTGTGATGTGTTTAACAAAGCCAAGAATAACCTATAAT---GATGTACTGAGTAAAGATGCTGGGGAATGTTCAATATGCCTTGAAGAGTTGCAGCAG
GGAGATACGATAGCACGACTGCCTTGTCTATGCATATATCATAAA---TGCATAGATGAATGGTTTGAAGTAAATAGATCTTGCCCTGAGCACCCTTCAG
ATTAA


>BGISUSP0000880792
----------------AYSGSDLPSSSSSSGGANGTAGSGARAAAAGRLPAQVPGAHQPSASGGAAAASAAPRSRSLGGAVGTVASGARAAQSTFSIPNS
SSGPYGSQDSVHSSPEDGGGGGSGGGRDRPAGGGPGGPRLVIGSLPAH----PVCSKFVPSDEMDLSLVMCLTKPRITYN-DVLSKDAGECSICLEELQQ
GDTIARLPCLCIYHK-CIDEWFEVNRSCPEHPSD*