Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000007237 (click for geneview)
Transcript ID ENST00000323816(link to ensembl)
Symbol GAS7
Localtion Chromosome:17:9754651:10042593:-1 band: 17p13.1
Description Growth-arrest-specific protein 7 (GAS-7). [Source:Uniprot/SWISSPROT;Acc:O60861]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--G--A--R--C--R--T--L--Y--P--F--S--G--E--R--H--G--Q--G--L--R--F--A--A--G--E--L--I--T--L--L--Q--
ATGTCCGGCGCTCGCTGCCGGACCCTGTACCCCTTCTCCGGGGAGCGGCACGGCCAGGGGCTGCGCTTCGCCGCGGGCGAGCTGATCACGCTGCTGCAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------><----------------
V--P--D--G--G--W--W--E--G--E--K--E--D--G--L--R--G--W--F--P--A--S--Y--V--Q--L--L--E--K--P--G--M--V--P
TCCCGGACGGCGGCTGGTGGGAAGGCGAGAAGGAGGACGGGCTCCGTGGCTGGTTCCCGGCGAGCTACGTGCAGTTGCTGGAGAAGCCTGGAATGGTCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--P--P--G--E--E--S--Q--T--V--I--L--P--P--G--W--Q--S--Y--L--S--P--Q--G--R--R--Y--Y--V--N--T--T--T-
CCCTCCGCCGGGAGAAGAAAGCCAGACGGTCATCCTTCCACCTGGCTGGCAGAGCTACCTGTCGCCTCAGGGCCGGCGGTACTATGTCAACACGACCACC
                                           ::::::::.::::::.:.:: :::::::::::::: :::::::::::::::.:::::
-------------------------------------------GGCTGGCAAAGCTACTTATCCCCTCAGGGCCGGCGCTACTATGTCAACACGGCCACC
--------------------------------------------G--W--Q--S--Y--L--S--P--Q--G--R--R--Y--Y--V--N--T--A--T-

---><-------------------------------------------------------------------------------><--------------
-N--E--T--T--W--E--R--P--S--S--S--P--G--I--P--A--S--P--G--S--H--R--S--S--L--P--P--T--V--N--G--Y--H--
AATGAGACCACCTGGGAACGTCCCAGCAGTTCTCCTGGGATTCCAGCCAGCCCTGGCTCTCACAGGAGCTCTCTGCCTCCAACAGTGAATGGATACCACG
:::   :::::::::::.:::::::::::::::: :::: :::::::::::::::::.::::::::::::::::::::::::::   ::::::.:::::.
AAT---ACCACCTGGGAGCGTCCCAGCAGTTCTCATGGGCTTCCAGCCAGCCCTGGCCCTCACAGGAGCTCTCTGCCTCCAACA---AATGGACACCACA
-N-----T--T--W--E--R--P--S--S--S--H--G--L--P--A--S--P--G--P--H--R--S--S--L--P--P--T-----N--G--H--H--

----------------------------------------------------------------------><----------------------------
A--S--G--T--P--A--H--P--P--E--T--A--H--M--S--V--R--K--S--T--G--D--S--Q--N--L--G--S--S--S--P--S--K--K
CATCAGGGACCCCAGCGCACCCTCCAGAGACTGCCCACATGAGTGTCCGAAAATCCACCGGTGATTCCCAGAACCTGGGATCCTCATCGCCAAGCAAAAA
:.::::::.::::.::::::::::: :::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::.:: :: .::::.:.
CGTCAGGGGCCCCGGCGCACCCTCCCGAGACTGCCCACATGAGTGTCCGAAAATCCACCGGCGATTCCCAGAACCTGGGATCCTCGTCCCCCGGCAAGAG
T--S--G--A--P--A--H--P--P--E--T--A--H--M--S--V--R--K--S--T--G--D--S--Q--N--L--G--S--S--S--P--G--K--R

------------------------><--------------------------------------------------------------------------
--Q--S--K--E--N--T--I--T--I--N--C--V--T--F--P--H--P--D--T--M--P--E--Q--Q--L--L--K--P--T--E--W--S--Y-
GCAGAGCAAGGAAAACACCATCACAATAAACTGTGTGACGTTCCCTCACCCAGACACGATGCCGGAACAGCAGCTGCTGAAACCAACCGAGTGGAGCTAC
::::::::::::::::::::::   ::::::::.::::::::::::::::::::::::::::: ::.:::::::::::::::::::::::::::::::::
GCAGAGCAAGGAAAACACCATC---ATAAACTGCGTGACGTTCCCTCACCCAGACACGATGCCCGAGCAGCAGCTGCTGAAACCAACCGAGTGGAGCTAC
--Q--S--K--E--N--T--I-----I--N--C--V--T--F--P--H--P--D--T--M--P--E--Q--Q--L--L--K--P--T--E--W--S--Y-

--------------><------------------------------------------------------------------------------------
-C--D--Y--F--W--A--D--K--K--D--P--Q--G--N--G--T--V--A--G--F--E--L--L--L--Q--K--Q--L--K--G--K--Q--M--
TGCGACTACTTCTGGGCTGATAAGAAGGACCCCCAAGGCAACGGCACCGTGGCTGGGTTTGAACTACTGCTCCAGAAACAGCTGAAGGGCAAACAAATGC
::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::.::::: :::::.:::::::::::::::::.::::
TGTGACTACTTCTGGGCTGATAAGAAGGACCCCCAAGGCAACGGCACCGTGGCTGGGTTTGAGCTGCTGCTGCAGAAGCAGCTGAAGGGCAAACAGATGC
-C--D--Y--F--W--A--D--K--K--D--P--Q--G--N--G--T--V--A--G--F--E--L--L--L--Q--K--Q--L--K--G--K--Q--M--

------------------------------><--------------------------------------------------------------------
Q--K--E--M--S--E--F--I--R--E--R--I--K--I--E--E--D--Y--A--K--N--L--A--K--L--S--Q--N--S--L--A--S--Q--E
AGAAGGAAATGTCAGAATTCATCCGGGAAAGGATAAAGATTGAAGAAGACTATGCGAAGAACTTAGCTAAGCTCTCTCAGAACTCCTTGGCTTCACAGGA
:::::::.:::::.::::::.::::::::                                                                       
AGAAGGAGATGTCGGAATTCGTCCGGGAA-----------------------------------------------------------------------
Q--K--E--M--S--E--F--V--R--E------------------------------------------------------------------------

-----><-----------------------------------------------------------------------------><--------------
--E--G--S--L--G--E--A--W--A--Q--V--K--K--S--L--A--D--E--A--E--V--H--L--K--F--S--A--K--L--H--S--E--V-
GGAAGGCTCCTTGGGAGAGGCGTGGGCCCAGGTGAAGAAGAGCCTGGCGGACGAAGCAGAAGTTCACCTCAAGTTCTCTGCCAAGCTTCACAGCGAGGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--K--P--L--M--N--F--R--E--N--F--K--K--D--M--K--K--C--D--H--H--I--A--D--L--R--K--Q--L--A--S--R--Y--
GAGAAGCCCCTGATGAACTTCCGTGAGAACTTCAAGAAAGACATGAAGAAGTGCGACCACCACATTGCCGACCTTCGCAAGCAGCTCGCCAGCCGCTATG
                                                :::::::::::::::::.:: :::::.::::::::::: .::::::::::.:
------------------------------------------------AAGTGCGACCACCACATCGCAGACCTCCGCAAGCAGCTGACCAGCCGCTACG
-------------------------------------------------K--C--D--H--H--I--A--D--L--R--K--Q--L--T--S--R--Y--

-------------><-------------------------------------------------------------------------------------
A--S--V--E--K--A--R--K--A--L--T--E--R--Q--R--D--L--E--M--K--T--Q--Q--L--E--I--K--L--S--N--K--T--E--E
CCTCGGTGGAGAAGGCCCGGAAAGCCCTCACAGAGCGGCAGAGAGACCTGGAGATGAAGACCCAGCAGCTGGAGATCAAGCTGAGCAACAAGACAGAGGA
:: :::::::::::::::::::.:: :::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::
CCGCGGTGGAGAAGGCCCGGAAGGCACTCACGGAGCGGCAGAGAGACCTGGAGATGAAGACCCAGCAGCTGGAGATCAAGCTGAGCAACAAGACGGAGGA
A--A--V--E--K--A--R--K--A--L--T--E--R--Q--R--D--L--E--M--K--T--Q--Q--L--E--I--K--L--S--N--K--T--E--E

-------------------------------------><-------------------------------------------------------------
--D--I--K--K--A--R--R--K--S--T--Q--A--G--D--D--L--M--R--C--V--D--L--Y--N--Q--A--Q--S--K--W--F--E--E-
GGACATCAAGAAGGCGCGGAGAAAGTCCACACAGGCTGGAGACGACCTCATGCGCTGTGTGGATCTCTACAACCAGGCCCAGTCCAAATGGTTTGAAGAG
:::::::::::::::.:::::.::::::::.:::                                                                  
GGACATCAAGAAGGCACGGAGGAAGTCCACGCAG------------------------------------------------------------------
--D--I--K--K--A--R--R--K--S--T--Q-------------------------------------------------------------------

-----------------><---------------------------------------------------------------------------------
-M--V--T--T--T--L--E--L--E--R--L--E--V--E--R--V--E--M--I--R--Q--H--L--C--Q--Y--T--Q--L--R--H--E--T--
ATGGTGACCACCACATTGGAGCTAGAGCGGCTGGAGGTGGAGAGGGTAGAGATGATCCGGCAGCACCTGTGCCAGTACACGCAGCTGCGGCATGAAACAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------><----------------------------------------------------------------------------------
D--M--F--N--Q--S--T--V--E--P--V--D--Q--L--L--R--K--V--D--P--A--K--D--R--E--L--W--V--R--E--H--K--T--G
ACATGTTCAACCAAAGCACAGTCGAGCCCGTGGATCAGCTGCTTCGAAAAGTGGACCCGGCCAAAGACAGGGAGCTGTGGGTCAGAGAGCACAAGACGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------>
--N--I--R--P--V--D--M--E--I--*-
CAACATCCGCCCTGTGGACATGGAGATCTAG
                               
-------------------------------
-------------------------------

Pig Consensus Sequence

>BGISUST0000879673
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------GGCTGGCAAAGCTACTTATCCCCTCAGGGCCGGCGCTACTATGTCAACACGGCCACC
AAT---ACCACCTGGGAGCGTCCCAGCAGTTCTCATGGGCTTCCAGCCAGCCCTGGCCCTCACAGGAGCTCTCTGCCTCCAACA---AATGGACACCACA
CGTCAGGGGCCCCGGCGCACCCTCCCGAGACTGCCCACATGAGTGTCCGAAAATCCACCGGCGATTCCCAGAACCTGGGATCCTCGTCCCCCGGCAAGAG
GCAGAGCAAGGAAAACACCATC---ATAAACTGCGTGACGTTCCCTCACCCAGACACGATGCCCGAGCAGCAGCTGCTGAAACCAACCGAGTGGAGCTAC
TGTGACTACTTCTGGGCTGATAAGAAGGACCCCCAAGGCAACGGCACCGTGGCTGGGTTTGAGCTGCTGCTGCAGAAGCAGCTGAAGGGCAAACAGATGC
AGAAGGAGATGTCGGAATTCGTCCGGGAA-----------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------AAGTGCGACCACCACATCGCAGACCTCCGCAAGCAGCTGACCAGCCGCTACG
CCGCGGTGGAGAAGGCCCGGAAGGCACTCACGGAGCGGCAGAGAGACCTGGAGATGAAGACCCAGCAGCTGGAGATCAAGCTGAGCAACAAGACGGAGGA
GGACATCAAGAAGGCACGGAGGAAGTCCACGCAG------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------


>BGISUSP0000879673
---------------------------------------------------------------------------------GWQSYLSPQGRRYYVNTAT
N-TTWERPSSSHGLPASPGPHRSSLPPT-NGHHTSGAPAHPPETAHMSVRKSTGDSQNLGSSSPGKRQSKENTI-INCVTFPHPDTMPEQQLLKPTEWSY
CDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFVRE---------------------------------------------------------
----------------KCDHHIADLRKQLTSRYAAVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKARRKSTQ----------------------
-----------------------------------------------------------------------------