Sequences
EST Library Info
cbe1Cerebellum
che4Heart - RNA from China
cje1Jejunum - RNA from China
cki3Kidney - RNA from China
cst6Stomach - RNA from China
cut1Uterus - RNA from China
eye1Foetus 50 days, Eye
fcc3Unavailable
hlv2Heart, left ventricle
lin1Large intestine
med1Mediastinum
mgp1Mammary gland - 7 days pre birth
nca1Newborn 115 days, cartillage
ova1Ovary
pgl1Pituitary gland
ste4M. Semitendinosus
sto2Stomach
uio1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000123297 (click for geneview)
Transcript ID ENST00000323833(link to ensembl)
Symbol NP_005717.2
Localtion Chromosome:12:56462849:56476634:1 band: 12q14.1
Description Ts translation elongation factor, mitochondrial
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------><------------------------------------------
-M--S--L--L--R--S--L--R--V--F--L--V--A--R--T--G--S--Y--P--A--G--S--L--L--R--Q--S--P--Q--P--R--H--T--
ATGTCGCTGCTGCGGTCGCTGCGCGTGTTTCTGGTCGCGCGGACCGGGAGCTACCCGGCTGGGTCTCTTCTGCGTCAGTCGCCCCAGCCAAGGCACACAT
                                                         :: :::.:.::::::: ::::::::: :::::..::::.::.:
---------------------------------------------------------GCGGGGCCCCTTCTGCTTCAGTCGCCGCAGCCGGGGCATACGT
----------------------------------------------------------A--G--P--L--L--L--Q--S--P--Q--P--G--H--T--

----------------------------------------------------------------------------------------------------
F--Y--A--G--P--R--L--S--A--S--A--S--S--K--E--L--L--M--K--L--R--R--K--T--G--Y--S--F--V--N--C--K--K--A
TTTATGCTGGGCCCCGTCTGTCTGCCTCGGCCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAAAACAGGCTACTCCTTTGTAAATTGCAAGAAAGC
::.:.:: ::::: .:.:::::.   :: ::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::.:::::::::::
TTCACGCAGGGCCATGCCTGTCC---TCCGCCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAAGACGGGCTACTCCTTTGTAAACTGCAAGAAAGC
F--H--A--G--P--C--L--S-----S--A--S--S--K--E--L--L--M--K--L--R--R--K--T--G--Y--S--F--V--N--C--K--K--A

------------------------------><--------------------------------------------------------------------
--L--E--T--C--G--G--D--L--K--Q--A--E--I--W--L--H--K--E--A--Q--K--E--G--W--S--K--A--A--K--L--Q--G--R-
TCTGGAGACTTGTGGCGGGGACCTCAAACAGGCAGAGATCTGGCTCCACAAGGAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCAAGGGAGG
::::::::::::.::.:::::.:::::::::::::::: ::::::::::::: ::::::::::::::::::::::.::::::::::.:::::: ::::::
TCTGGAGACTTGCGGTGGGGATCTCAAACAGGCAGAGAGCTGGCTCCACAAGCAGGCCCAGAAGGAGGGCTGGAGTAAAGCTGCCAGGCTCCATGGGAGG
--L--E--T--C--G--G--D--L--K--Q--A--E--S--W--L--H--K--Q--A--Q--K--E--G--W--S--K--A--A--R--L--H--G--R-

-----------------------------------------------------------><---------------------------------------
-K--T--K--E--G--L--I--G--L--L--Q--E--G--N--T--T--V--L--V--E--V--N--C--E--T--D--F--V--S--R--N--L--K--
AAGACCAAAGAAGGCCTGATTGGGCTGTTGCAGGAAGGAAACACAACTGTATTAGTAGAGGTAAACTGTGAGACAGATTTTGTTTCTAGAAATTTAAAAT
:::::.::::::::.::::::::::::.:::::::::::::::::: :::.::.::::::::::::::::::::::::::::::::.:::::.:::::::
AAGACTAAAGAAGGTCTGATTGGGCTGCTGCAGGAAGGAAACACAAGTGTGTTGGTAGAGGTAAACTGTGAGACAGATTTTGTTTCCAGAAACTTAAAAT
-K--T--K--E--G--L--I--G--L--L--Q--E--G--N--T--S--V--L--V--E--V--N--C--E--T--D--F--V--S--R--N--L--K--

----------------------------------------------------------------------------------><----------------
F--Q--L--L--V--Q--Q--V--A--L--G--T--M--M--H--C--Q--T--L--K--D--Q--P--S--A--Y--S--K--V--Q--W--L--T--P
TTCAACTGTTGGTCCAGCAAGTAGCCCTTGGAACCATGATGCATTGTCAGACCCTAAAGGATCAACCCTCTGCATACAGTAAAGTGCAGTGGCTCACGCC
:::::: .:::::::::::::::::::: :::::: :: ::::.::::::: ::::::::::: ::.:::..:.::.::::::                 
TTCAACAATTGGTCCAGCAAGTAGCCCTGGGAACCCTGTTGCACTGTCAGAGCCTAAAGGATCCACTCTCCACGTATAGTAAA-----------------
F--Q--Q--L--V--Q--Q--V--A--L--G--T--L--L--H--C--Q--S--L--K--D--P--L--S--T--Y--S--K------------------

---------------------------------------------><-----------------------------------------------------
--V--N--L--A--L--W--E--A--E--A--G--G--S--L--E--G--F--L--N--S--S--E--L--S--G--L--P--A--G--P--D--R--E-
TGTAAACCTAGCACTTTGGGAGGCTGAAGCAGGTGGATCACTTGAGGGTTTCTTGAATTCCTCTGAGCTTTCTGGACTTCCAGCTGGGCCTGACAGAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------><-----------------------------------------------------------------
-G--S--L--K--D--Q--L--A--L--A--I--G--K--L--G--E--N--M--I--L--K--R--A--A--W--V--K--V--P--S--G--F--Y--
GGCTCACTCAAGGATCAGTTGGCTTTAGCAATTGGAAAACTGGGAGAAAACATGATTCTTAAACGAGCTGCATGGGTGAAGGTGCCATCTGGGTTCTACG
                                    :::::::::::::::::::.::::::::::::::::::::::::::::::: ::::::::::.:
------------------------------------AAACTGGGAGAAAACATGACTCTTAAACGAGCTGCATGGGTGAAGGTGCCAGCTGGGTTCTATG
-------------------------------------K--L--G--E--N--M--T--L--K--R--A--A--W--V--K--V--P--A--G--F--Y--

----------------------------------------------------------------------------------------------------
V--G--S--Y--V--H--G--A--M--Q--S--P--S--L--H--K--L--V--L--G--K--Y--G--A--L--V--I--C--E--T--S--E--Q--K
TTGGCTCTTATGTCCACGGAGCAATGCAGAGTCCCTCACTTCACAAGCTGGTGCTGGGGAAGTATGGGGCCCTGGTCATCTGTGAGACGTCTGAACAGAA
: ::::::::::::::.::..:::::::::::::::::::.::::: :::::::::::::::::::::::::::::::::::.:::::::::::.:.:::
TGGGCTCTTATGTCCATGGGACAATGCAGAGTCCCTCACTCCACAACCTGGTGCTGGGGAAGTATGGGGCCCTGGTCATCTGCGAGACGTCTGAGCGGAA
V--G--S--Y--V--H--G--T--M--Q--S--P--S--L--H--N--L--V--L--G--K--Y--G--A--L--V--I--C--E--T--S--E--R--K

----------------------------------------------------------------------------------------------------
--T--N--L--E--D--V--G--R--R--L--G--Q--H--V--V--G--M--A--P--L--S--V--G--S--L--D--D--E--P--G--G--E--A-
AACAAACCTTGAAGACGTTGGCCGCCGCCTTGGGCAGCATGTGGTGGGCATGGCCCCCCTCTCTGTTGGCTCCCTGGACGATGAGCCTGGGGGAGAGGCA
:.:::::::::::::: ::::::::::::::::::::::.::::::::::::::.::.::::::::::::::::::::::::::::::::::::::::::
AGCAAACCTTGAAGACCTTGGCCGCCGCCTTGGGCAGCACGTGGTGGGCATGGCTCCTCTCTCTGTTGGCTCCCTGGACGATGAGCCTGGGGGAGAGGCA
--A--N--L--E--D--L--G--R--R--L--G--Q--H--V--V--G--M--A--P--L--S--V--G--S--L--D--D--E--P--G--G--E--A-

----------------------------------------------------------------------------------------------------
-E--T--K--M--L--S--Q--P--Y--L--L--D--P--S--I--T--L--G--Q--Y--V--Q--P--Q--G--V--S--V--V--D--F--V--R--
GAGACTAAGATGCTGTCCCAGCCGTATTTGCTGGATCCCTCCATTACCTTGGGGCAGTATGTGCAGCCTCAGGGGGTGTCGGTAGTAGACTTTGTGCGGT
::.::.:::::::::::::::::.::.:::::::::::::::::.:: .: ::.::::::::::::::.::.:::::.:: :::::::::::::::::::
GAAACCAAGATGCTGTCCCAGCCATACTTGCTGGATCCCTCCATCACACTTGGACAGTATGTGCAGCCCCAAGGGGTATCTGTAGTAGACTTTGTGCGGT
-E--T--K--M--L--S--Q--P--Y--L--L--D--P--S--I--T--L--G--Q--Y--V--Q--P--Q--G--V--S--V--V--D--F--V--R--

---------------------------------------->
F--E--C--G--E--G--E--E--A--A--E--T--E--*-
TTGAATGTGGAGAAGGTGAAGAGGCAGCAGAAACTGAATAG
:.::::::::::::::.:::::: .::::::..:.::::::
TCGAATGTGGAGAAGGCGAAGAGCTAGCAGAGGCCGAATAG
F--E--C--G--E--G--E--E--L--A--E--A--E--*-

Pig Consensus Sequence

>BGISUST0000886128
---------------------------------------------------------GCGGGGCCCCTTCTGCTTCAGTCGCCGCAGCCGGGGCATACGT
TTCACGCAGGGCCATGCCTGTCCTCCGCCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAAGACGGGCTACTCCTTTGTAAACTGCAAGAAAGCTCT
GGAGACTTGCGGTGGGGATCTCAAACAGGCAGAGAGCTGGCTCCACAAGCAGGCCCAGAAGGAGGGCTGGAGTAAAGCTGCCAGGCTCCATGGGAGGAAG
ACTAAAGAAGGTCTGATTGGGCTGCTGCAGGAAGGAAACACAAGTGTGTTGGTAGAGGTAAACTGTGAGACAGATTTTGTTTCCAGAAACTTAAAATTTC
AACAATTGGTCCAGCAAGTAGCCCTGGGAACCCTGTTGCACTGTCAGAGCCTAAAGGATCCACTCTCCACGTATAGTAAA--------------------
----------------------------------------------------------------------------------------------------
---------------------------------AAACTGGGAGAAAACATGACTCTTAAACGAGCTGCATGGGTGAAGGTGCCAGCTGGGTTCTATGTGG
GCTCTTATGTCCATGGGACAATGCAGAGTCCCTCACTCCACAACCTGGTGCTGGGGAAGTATGGGGCCCTGGTCATCTGCGAGACGTCTGAGCGGAAAGC
AAACCTTGAAGACCTTGGCCGCCGCCTTGGGCAGCACGTGGTGGGCATGGCTCCTCTCTCTGTTGGCTCCCTGGACGATGAGCCTGGGGGAGAGGCAGAA
ACCAAGATGCTGTCCCAGCCATACTTGCTGGATCCCTCCATCACACTTGGACAGTATGTGCAGCCCCAAGGGGTATCTGTAGTAGACTTTGTGCGGTTCG
AATGTGGAGAAGGCGAAGAGCTAGCAGAGGCCGAATAG


>BGISUSP0000886128
-------------------AGPLLLQSPQPGHTFHAGPCLSSASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAESWLHKQAQKEGWSKAARLHGRK
TKEGLIGLLQEGNTSVLVEVNCETDFVSRNLKFQQLVQQVALGTLLHCQSLKDPLSTYSK----------------------------------------
-----------KLGENMTLKRAAWVKVPAGFYVGSYVHGTMQSPSLHNLVLGKYGALVICETSERKANLEDLGRRLGQHVVGMAPLSVGSLDDEPGGEAE
TKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEELAEAE*