Sequences
EST Library Info
relu1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000181982 (click for geneview)
Transcript ID ENST00000324309(link to ensembl)
Symbol NP_775734.1
Localtion Chromosome:4:24504850:24658095:-1 band: 4p15.2
Description hypothetical protein DKFZp761B107
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------------><-------------------------------------><
-M--A--N--Q--L--R--E--R--H--Q--S--L--K--K--K--Y--R--E--L--I--D--G--D--P--S--L--P--P--E--K--R--K--Q--
ATGGCCAATCAGCTCCGGGAGCGCCACCAGTCACTGAAGAAGAAGTACCGAGAGCTGATTGATGGAGATCCATCACTTCCTCCTGAAAAAAGGAAACAGG
            ::.::.:::::::::::::: ::::::::::::::::: ::::::                                           
------------CTTCGAGAGCGCCACCAGTCCCTGAAGAAGAAGTACCGCGAGCTG-------------------------------------------
-------------L--R--E--R--H--Q--S--L--K--K--K--Y--R--E--L--------------------------------------------

----------------------------------------------------------------------------------------------------
A--N--L--A--Q--L--L--R--D--S--Q--D--R--N--K--H--L--G--E--E--I--K--E--L--Q--Q--R--L--G--E--V--Q--G--D
CTAATCTTGCACAACTATTGAGAGATTCTCAGGACCGAAATAAACATCTGGGAGAAGAAATTAAAGAACTTCAGCAAAGGCTTGGAGAAGTCCAGGGCGA
     ::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::
-----CTTGCACAACTATTGAGAGATTCTCAAGACCGAAATAAACATCTGGGAGAAGAAATTAAAGAACTCCAGCAAAGGCTTGGAGAAGTCCAGGGCGA
------L--A--Q--L--L--R--D--S--Q--D--R--N--K--H--L--G--E--E--I--K--E--L--Q--Q--R--L--G--E--V--Q--G--D

------><--------------------------------------------------------------------------------------------
--N--K--L--L--R--M--T--I--A--K--Q--R--L--G--D--E--A--I--G--V--R--H--F--A--A--H--E--R--E--D--L--V--Q-
CAACAAGCTCTTGAGGATGACGATTGCCAAACAAAGGCTCGGAGACGAAGCAATCGGCGTGCGACACTTTGCAGCCCATGAGCGTGAAGACTTGGTGCAG
:::.:::::::::::::::::.:::::::::::.:::::.::.::.:::: :::.::.:::::.::::::::.:::::.:::::::::::..:::: :::
CAATAAGCTCTTGAGGATGACAATTGCCAAACAGAGGCTTGGGGATGAAGAAATTGGTGTGCGGCACTTTGCGGCCCACGAGCGTGAAGATCTGGTTCAG
--N--K--L--L--R--M--T--I--A--K--Q--R--L--G--D--E--E--I--G--V--R--H--F--A--A--H--E--R--E--D--L--V--Q-

-----------------------><---------------------------------------------------------------------------
-Q--L--E--R--A--K--E--Q--I--E--S--L--E--H--D--L--Q--A--S--V--D--E--L--Q--D--V--K--E--E--R--S--S--Y--
CAGCTAGAGCGAGCTAAGGAACAGATTGAGTCTCTGGAGCACGACCTGCAGGCTTCTGTGGACGAGCTTCAGGATGTTAAAGAAGAACGGTCTTCCTACC
:::::.::: ::::::::::::::::.::.:::::::::::::::::::::::.::::::::::::::::::::::: ::::::::::::::::::::::
CAGCTGGAGAGAGCTAAGGAACAGATCGAATCTCTGGAGCACGACCTGCAGGCCTCTGTGGACGAGCTTCAGGATGTGAAAGAAGAACGGTCTTCCTACC
-Q--L--E--R--A--K--E--Q--I--E--S--L--E--H--D--L--Q--A--S--V--D--E--L--Q--D--V--K--E--E--R--S--S--Y--

----------------------------------------------------------------------------------------------><----
Q--D--K--V--E--R--L--N--Q--E--L--N--H--I--L--S--G--H--E--N--R--I--I--D--V--D--A--L--C--M--E--N--Y--L
AGGACAAAGTGGAGAGGCTCAACCAGGAGCTGAACCATATCCTGAGTGGGCACGAGAACCGCATCATTGACGTGGACGCCCTGTGTATGGAGAACTACCT
:::::::::: :::::::::::::::::::: :::::.::::::::.:: :::::::::::.:::::::::::::::::::::::.::::::::::::::
AGGACAAAGTCGAGAGGCTCAACCAGGAGCTCAACCACATCCTGAGCGGTCACGAGAACCGTATCATTGACGTGGACGCCCTGTGCATGGAGAACTACCT
Q--D--K--V--E--R--L--N--Q--E--L--N--H--I--L--S--G--H--E--N--R--I--I--D--V--D--A--L--C--M--E--N--Y--L

------------------------------------------------------------------><--------------------------------
--Q--E--R--L--K--Q--L--H--E--E--V--N--L--L--K--S--N--I--A--K--Y--K--N--A--L--E--R--R--K--N--S--K--G-
TCAAGAGAGATTAAAGCAACTCCATGAAGAGGTCAACCTCTTGAAATCAAACATTGCCAAATACAAGAATGCTCTGGAGAGACGGAAAAACTCGAAGGGC
:::::::::::::::::::::.:::::::::::::::::::::::::: :::::::::::::::::::::::::: ::::::::::::::.:: ::.:::
TCAAGAGAGATTAAAGCAACTTCATGAAGAGGTCAACCTCTTGAAATCTAACATTGCCAAATACAAGAATGCTCTCGAGAGACGGAAAAATTCCAAAGGC
--Q--E--R--L--K--Q--L--H--E--E--V--N--L--L--K--S--N--I--A--K--Y--K--N--A--L--E--R--R--K--N--S--K--G-

---------------------------------------------------><-----------------------------------------------
-Q--G--K--S--S--S--S--A--L--T--G--V--L--S--A--K--Q--V--Q--D--L--L--S--E--D--H--G--C--S--L--P--A--T--
CAGGGTAAATCCAGCAGCAGTGCTCTGACAGGAGTCCTGTCTGCAAAGCAAGTTCAGGATCTGCTATCTGAGGATCATGGATGCAGCCTCCCAGCTACTC
:::::::::::::::::::::::..:::: ::::::::::: :::::::::   :::::.::::: ::.::::::::.::.:::::.::::::::.::::
CAGGGTAAATCCAGCAGCAGTGCCTTGACTGGAGTCCTGTCGGCAAAGCAA---CAGGACCTGCTCTCCGAGGATCACGGGTGCAGTCTCCCAGCCACTC
-Q--G--K--S--S--S--S--A--L--T--G--V--L--S--A--K--Q-----Q--D--L--L--S--E--D--H--G--C--S--L--P--A--T--

----------------------------------------------------------------------------------------------------
P--Q--S--I--S--D--L--K--S--L--A--T--A--L--L--E--T--I--H--E--K--N--M--V--I--Q--H--Q--R--Q--T--N--K--*
CGCAGTCCATTTCTGACCTGAAATCTCTGGCAACAGCCCTGTTGGAAACAATCCACGAGAAAAACATGGTCATTCAGCACCAGAGGCAAACCAACAAGTA
:.::::::::::::::.::::::::::::::::::::.::::::::.::.:::::.:::::::::::::: ::.::::::::::::::.::::::     
CACAGTCCATTTCTGATCTGAAATCTCTGGCAACAGCTCTGTTGGAGACGATCCATGAGAAAAACATGGTGATCCAGCACCAGAGGCAGACCAAC-----
P--Q--S--I--S--D--L--K--S--L--A--T--A--L--L--E--T--I--H--E--K--N--M--V--I--Q--H--Q--R--Q--T--N------

>
-
G
 
-
-

Pig Consensus Sequence

>BGISUST0000882346
------------CTTCGAGAGCGCCACCAGTCCCTGAAGAAGAAGTACCGCGAGCTG-------------------------------------------
-----CTTGCACAACTATTGAGAGATTCTCAAGACCGAAATAAACATCTGGGAGAAGAAATTAAAGAACTCCAGCAAAGGCTTGGAGAAGTCCAGGGCGA
CAATAAGCTCTTGAGGATGACAATTGCCAAACAGAGGCTTGGGGATGAAGAAATTGGTGTGCGGCACTTTGCGGCCCACGAGCGTGAAGATCTGGTTCAG
CAGCTGGAGAGAGCTAAGGAACAGATCGAATCTCTGGAGCACGACCTGCAGGCCTCTGTGGACGAGCTTCAGGATGTGAAAGAAGAACGGTCTTCCTACC
AGGACAAAGTCGAGAGGCTCAACCAGGAGCTCAACCACATCCTGAGCGGTCACGAGAACCGTATCATTGACGTGGACGCCCTGTGCATGGAGAACTACCT
TCAAGAGAGATTAAAGCAACTTCATGAAGAGGTCAACCTCTTGAAATCTAACATTGCCAAATACAAGAATGCTCTCGAGAGACGGAAAAATTCCAAAGGC
CAGGGTAAATCCAGCAGCAGTGCCTTGACTGGAGTCCTGTCGGCAAAGCAA---CAGGACCTGCTCTCCGAGGATCACGGGTGCAGTCTCCCAGCCACTC
CACAGTCCATTTCTGATCTGAAATCTCTGGCAACAGCTCTGTTGGAGACGATCCATGAGAAAAACATGGTGATCCAGCACCAGAGGCAGACCAAC-----
-


>BGISUSP0000882346
----LRERHQSLKKKYREL----------------LAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRLGDEEIGVRHFAAHEREDLVQ
QLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERLNQELNHILSGHENRIIDVDALCMENYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKG
QGKSSSSALTGVLSAKQ-QDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTN--