Sequences
EST Library Info
cki3Kidney - RNA from China
Clusters
Oligos
SNPs

Gene ID ENSG00000131183 (click for geneview)
Transcript ID ENST00000324417(link to ensembl)
Symbol SLC34A1
Localtion Chromosome:5:176744051:176758454:1 band: 5q35.3
Description Renal sodium-dependent phosphate transport protein 2 (Sodium/phosphate cotransporter 2) (Na(+)/Pi cotransporter 2) (Renal sodium-phosphate transport protein 2) (Renal Na(+)-dependent phosphate cotransporter 2). [Source:Uniprot/SWISSPROT;Acc:Q06495]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--L--S--Y--G--E--R--L--G--S--P--A--V--S--P--L--P--V--R--G--G--H--V--M--R--G--T--A--F--A--Y--V--P--
ATGTTGTCCTACGGAGAGAGGCTGGGGTCCCCTGCTGTCTCCCCACTCCCAGTCCGTGGGGGGCATGTGATGCGAGGGACGGCCTTTGCCTACGTGCCCA
::: :::::::::::::::::::::::  ::: :::.:::::::.:::::::::::.::::::::..::::::: :::.::.::::::::::::::::::
ATGATGTCCTACGGAGAGAGGCTGGGGGGCCCGGCTATCTCCCCGCTCCCAGTCCGCGGGGGGCACATGATGCGTGGGGCGACCTTTGCCTACGTGCCCA
-M--M--S--Y--G--E--R--L--G--G--P--A--I--S--P--L--P--V--R--G--G--H--M--M--R--G--A--T--F--A--Y--V--P--

--------><------------------------------------------------------------------------------------------
S--P--Q--V--L--H--R--I--P--G--T--S--A--Y--A--F--P--S--L--G--P--V--A--L--A--E--H--T--C--P--C--G--E--V
GCCCTCAGGTCCTACACAGGATCCCGGGGACCTCTGCCTATGCCTTCCCCAGCCTGGGCCCTGTGGCCCTTGCTGAGCACACCTGCCCCTGTGGGGAGGT
:::: :::   ::.:::::::::::.:::::::: :::::::::::::::::::::::::::::::::::..:.::::::. ::::.:::.:::::::::
GCCCGCAG---CTGCACAGGATCCCAGGGACCTCAGCCTATGCCTTCCCCAGCCTGGGCCCTGTGGCCCTCACCGAGCACGGCTGCTCCTATGGGGAGGT
S--P--Q-----L--H--R--I--P--G--T--S--A--Y--A--F--P--S--L--G--P--V--A--L--T--E--H--G--C--S--Y--G--E--V

----------------------------------------------------------><----------------------------------------
--L--E--R--H--E--P--L--P--A--K--L--A--L--E--E--E--Q--K--P--E--S--R--L--V--P--K--L--R--Q--A--G--A--M-
CCTGGAGCGCCATGAACCACTGCCTGCCAAGCTGGCCCTGGAGGAGGAGCAGAAGCCAGAGTCCAGGCTGGTCCCCAAGCTGCGCCAGGCTGGCGCCATG
.:::::::::::::: ::.:::::. ::::::::::::::::::::::.:::::::::   .: .::.:::.::  :::::::::::::::::: : :::
TCTGGAGCGCCATGACCCGCTGCCCTCCAAGCTGGCCCTGGAGGAGGAACAGAAGCCA---CCAGGGTTGGCCCAGAAGCTGCGCCAGGCTGGCTCAATG
--L--E--R--H--D--P--L--P--S--K--L--A--L--E--E--E--Q--K--P-----P--G--L--A--Q--K--L--R--Q--A--G--S--M-

---------------------------------------------------------------------------------------><-----------
-L--L--K--V--P--L--M--L--T--F--L--Y--L--F--V--C--S--L--D--M--L--S--S--A--F--Q--L--A--G--G--K--V--A--
CTGCTCAAGGTGCCACTGATGCTCACCTTCCTCTACCTCTTCGTCTGCTCCCTGGACATGCTCAGCTCGGCCTTCCAGCTGGCTGGAGGGAAGGTGGCTG
:: :::::::::::.::::::::..::::::::::::::::.:::::::::::::::.::::::::::.::::::::::::::::::   ::::::::::
CTCCTCAAGGTGCCGCTGATGCTTGCCTTCCTCTACCTCTTTGTCTGCTCCCTGGACGTGCTCAGCTCAGCCTTCCAGCTGGCTGGA---AAGGTGGCTG
-L--L--K--V--P--L--M--L--A--F--L--Y--L--F--V--C--S--L--D--V--L--S--S--A--F--Q--L--A--G-----K--V--A--

----------------------------------------------------------------------------------------------------
G--D--I--F--K--D--N--A--I--L--S--N--P--V--A--G--L--V--V--G--I--L--V--T--V--L--V--Q--S--S--S--T--S--T
GTGACATCTTCAAGGATAACGCCATCCTGTCCAACCCGGTGGCCGGGCTGGTGGTGGGGATCCTGGTGACCGTGCTGGTGCAGAGCTCCAGCACCTCCAC
:.::::::::::::::.::::::::::::::::::::.::.:: ::::::::::::::::::::.:::::::::::::::::::::::::::::::::::
GCGACATCTTCAAGGACAACGCCATCCTGTCCAACCCAGTAGCAGGGCTGGTGGTGGGGATCCTAGTGACCGTGCTGGTGCAGAGCTCCAGCACCTCCAC
G--D--I--F--K--D--N--A--I--L--S--N--P--V--A--G--L--V--V--G--I--L--V--T--V--L--V--Q--S--S--S--T--S--T

-------------------------------><-------------------------------------------------------------------
--S--I--I--V--S--M--V--S--S--G--L--L--E--V--S--S--A--I--P--I--I--M--G--S--N--I--G--T--S--V--T--N--T-
ATCCATCATCGTCAGCATGGTCTCCTCTGGCTTGCTGGAGGTGAGCTCTGCCATCCCCATCATCATGGGCTCCAACATCGGCACCTCTGTCACCAACACC
:::::::::.:::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::
ATCCATCATTGTCAGCATGGTCTCCTCTGGC---CTGGAGGTGAGCTCTGCCATCCCCATCATCATGGGCTCCAACATCGGCACCTCGGTCACCAACACC
--S--I--I--V--S--M--V--S--S--G-----L--E--V--S--S--A--I--P--I--I--M--G--S--N--I--G--T--S--V--T--N--T-

-------------------------------------------><-------------------------------------------------------
-I--V--A--L--M--Q--A--G--D--R--T--D--F--R--R--A--F--A--G--A--T--V--H--D--C--F--N--W--L--S--V--L--V--
ATCGTGGCCCTGATGCAGGCGGGGGACAGGACTGACTTCCGGCGGGCCTTCGCGGGGGCCACGGTGCATGACTGCTTTAACTGGCTGTCAGTGCTGGTCC
::::::::::::::::::::::::::::::::::::::::::   ::::::::::::::::: :::::.:::::.::::::::::: :::::  ::::::
ATCGTGGCCCTGATGCAGGCGGGGGACAGGACTGACTTCCGG---GCCTTCGCGGGGGCCACCGTGCACGACTGTTTTAACTGGCTCTCAGTTGTGGTCC
-I--V--A--L--M--Q--A--G--D--R--T--D--F--R-----A--F--A--G--A--T--V--H--D--C--F--N--W--L--S--V--V--V--

----------------------------------------------------------------------------------------------------
L--L--P--L--E--A--A--T--G--Y--L--H--H--I--T--R--L--V--V--A--S--F--N--I--H--G--G--R--D--A--P--D--L--L
TGCTGCCCCTGGAGGCTGCCACTGGCTACCTGCACCACATCACTCGACTTGTGGTGGCCTCCTTCAACATCCATGGTGGCCGTGATGCTCCTGACCTGCT
:::::::::::::.::::::::.:: :::::::::.::.::::::::::::::::.::::::::::::::::.::::::::::::..:.:::::::::::
TGCTGCCCCTGGAAGCTGCCACCGGGTACCTGCACTACGTCACTCGACTTGTGGTAGCCTCCTTCAACATCCGTGGTGGCCGTGACACCCCTGACCTGCT
L--L--P--L--E--A--A--T--G--Y--L--H--Y--V--T--R--L--V--V--A--S--F--N--I--R--G--G--R--D--T--P--D--L--L

---------------------------------------><-----------------------------------------------------------
--K--I--I--T--E--P--F--T--K--L--I--I--Q--L--D--E--S--V--I--T--S--I--A--T--G--D--E--S--L--R--N--H--S-
CAAGATCATCACAGAGCCCTTCACGAAGCTCATCATCCAGCTGGACGAGTCTGTGATAACCAGCATTGCCACTGGTGATGAGTCCCTGAGGAACCACAGT
::::::::::::.:::::.::::: :::::::::::::::                                                            
CAAGATCATCACGGAGCCTTTCACTAAGCTCATCATCCAG------------------------------------------------------------
--K--I--I--T--E--P--F--T--K--L--I--I--Q-------------------------------------------------------------

-----------------------------------><---------------------------------------------------------------
-L--I--Q--I--W--C--H--P--D--S--L--Q--A--P--T--S--M--S--R--A--E--A--N--S--S--Q--T--L--G--N--A--T--M--
CTCATCCAGATCTGGTGCCACCCAGACTCCTTACAGGCTCCCACCTCCATGTCCAGAGCAGAGGCCAACTCCAGCCAGACCCTTGGAAATGCCACCATGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----><---------------------------------------------------------------------------------------------
E--K--C--N--H--I--F--V--D--T--G--L--P--D--L--A--V--G--L--I--L--L--A--G--S--L--V--L--L--C--T--C--L--I
AGAAATGCAACCACATCTTTGTGGACACTGGCCTACCGGACCTGGCTGTGGGGCTCATCCTGCTGGCAGGATCCCTGGTGCTGCTGTGCACCTGCCTCAT
        :::::::::::.:::::::: :: ::.:: ::::::::.:::::::::::::::::::: :: ::::::::.:: :: ::::::::::::::
--------AACCACATCTTCGTGGACACAGGGCTGCCTGACCTGGCCGTGGGGCTCATCCTGCTGGCTGGCTCCCTGGTACTCCTCTGCACCTGCCTCAT
---------N--H--I--F--V--D--T--G--L--P--D--L--A--V--G--L--I--L--L--A--G--S--L--V--L--L--C--T--C--L--I

-------------------------------------------------------------------------><-------------------------
--L--L--V--K--M--L--N--S--L--L--K--G--Q--V--A--K--V--I--Q--K--V--I--N--T--D--F--P--A--P--F--T--W--V-
CCTCCTAGTCAAGATGCTCAACTCCCTGCTCAAGGGCCAAGTGGCCAAGGTCATCCAGAAGGTCATCAATACGGACTTCCCTGCCCCCTTCACCTGGGTC
:::::: :::::::::::::::::.::::::::::::::.::::::::::::::.::::::::.:::::.      :::::::::::::::::::::   
CCTCCTCGTCAAGATGCTCAACTCTCTGCTCAAGGGCCAGGTGGCCAAGGTCATTCAGAAGGTTATCAAC------TTCCCTGCCCCCTTCACCTGG---
--L--L--V--K--M--L--N--S--L--L--K--G--Q--V--A--K--V--I--Q--K--V--I--N--------F--P--A--P--F--T--W----

---------------------------------------------------------------------------------------------><-----
-T--G--Y--F--A--M--V--V--G--A--S--M--T--F--V--V--Q--S--S--S--V--F--T--S--A--I--T--P--L--I--G--L--G--
ACAGGCTACTTTGCCATGGTGGTGGGCGCCAGCATGACCTTCGTGGTCCAGAGCAGTTCTGTGTTCACCTCGGCCATCACCCCACTCATCGGTCTTGGTG
   :::::::::::::::::::::::::::.:::::::.::::: ::::::::::::::::::::::::::::::::::::::::::      :: ::::
CA-GGCTACTTTGCCATGGTGGTGGGCGCCGGCATGACTTTCGTCGTCCAGAGCAGTTCTGTGTTCACCTCGGCCATCACCCCACTC------CTAGGTG
-T--G--Y--F--A--M--V--V--G--A--G--M--T--F--V--V--Q--S--S--S--V--F--T--S--A--I--T--P--L--------L--G--

----------------------------------------------------------------------------------------------------
V--I--S--I--E--R--A--Y--P--L--T--L--G--S--N--I--G--T--T--T--T--A--I--L--A--A--L--A--S--P--R--E--K--L
TGATCAGCATTGAGAGGGCCTACCCGCTCACACTGGGTTCCAACATCGGCACCACCACCACGGCCATCCTGGCTGCCCTGGCCAGCCCCAGGGAGAAGCT
:.::::::::.::. : ::::::::::::::::::::.:::::::::::::::::::::::.::::::::::: :: :::::::::::: ::::::::::
TAATCAGCATCGAACGCGCCTACCCGCTCACACTGGGCTCCAACATCGGCACCACCACCACAGCCATCCTGGCGGCACTGGCCAGCCCCCGGGAGAAGCT
V--I--S--I--E--R--A--Y--P--L--T--L--G--S--N--I--G--T--T--T--T--A--I--L--A--A--L--A--S--P--R--E--K--L

------------------><--------------------------------------------------------------------------------
--S--S--A--F--Q--I--A--L--C--H--F--F--F--N--I--S--G--I--L--L--W--Y--P--V--P--C--T--R--L--P--I--R--M-
GTCCAGCGCTTTCCAGATTGCCCTCTGTCACTTCTTCTTCAACATCTCGGGTATCCTTCTGTGGTACCCGGTGCCCTGCACACGCCTGCCCATCCGCATG
::::::.:::::::::::.::::::::.::.::::::::::::::::::::.::::: :::::::::::.::::::::::..::::::::::::::::::
GTCCAGTGCTTTCCAGATCGCCCTCTGCCATTTCTTCTTCAACATCTCGGGCATCCTGCTGTGGTACCCAGTGCCCTGCATGCGCCTGCCCATCCGCATG
--S--S--A--F--Q--I--A--L--C--H--F--F--F--N--I--S--G--I--L--L--W--Y--P--V--P--C--M--R--L--P--I--R--M-

----------------------------------------------------------------------------------------------------
-A--K--A--L--G--K--R--T--A--K--Y--R--W--F--A--V--L--Y--L--L--V--C--F--L--L--L--P--S--L--V--F--G--I--
GCCAAGGCGCTGGGGAAACGCACGGCCAAGTACCGCTGGTTTGCCGTCCTCTATCTCCTTGTCTGCTTCCTGCTGCTGCCCTCACTGGTGTTTGGCATCT
::::::::::::::::::::.:: :::::.:::::::::::.:::::::::::::::::. : ::::::::::::::::::::.::::::::::::::::
GCCAAGGCGCTGGGGAAACGTACCGCCAAATACCGCTGGTTCGCCGTCCTCTATCTCCTCCTGTGCTTCCTGCTGCTGCCCTCGCTGGTGTTTGGCATCT
-A--K--A--L--G--K--R--T--A--K--Y--R--W--F--A--V--L--Y--L--L--L--C--F--L--L--L--P--S--L--V--F--G--I--

----------------------------------------------------------------------------------------------------
S--M--A--G--W--Q--V--M--V--G--V--G--T--P--F--G--A--L--L--A--F--V--V--L--I--N--V--L--Q--S--R--S--P--G
CCATGGCAGGCTGGCAGGTCATGGTAGGTGTGGGCACGCCCTTCGGGGCCCTGCTGGCCTTCGTGGTGCTCATCAATGTCCTGCAGAGTCGGAGTCCCGG
::::::::::::::::::.::::::::::::::::.:.::::::::.::::::::::::::.:::::.::..::::..: ::::::::.:: ::.:::::
CCATGGCAGGCTGGCAGGCCATGGTAGGTGTGGGCGCACCCTTCGGAGCCCTGCTGGCCTTTGTGGTACTTGTCAACATGCTGCAGAGCCGCAGCCCCGG
S--M--A--G--W--Q--A--M--V--G--V--G--A--P--F--G--A--L--L--A--F--V--V--L--V--N--M--L--Q--S--R--S--P--G

----------------------------------------------------------------------------------------------------
--H--L--P--K--W--L--Q--T--W--D--F--L--P--R--W--M--H--S--L--K--P--L--D--H--L--I--T--R--A--T--L--C--C-
GCACCTGCCCAAGTGGTTACAGACATGGGACTTCCTGCCTCGCTGGATGCACTCCCTGAAGCCCCTGGACCACCTCATCACCCGCGCCACCCTATGCTGT
::::::::::::::::.::::::: ::::::::::::::::: ::::::::::::::: ::::::::::::.:::::::.::::.::::::.:.::::::
GCACCTGCCCAAGTGGCTACAGACTTGGGACTTCCTGCCTCGGTGGATGCACTCCCTGCAGCCCCTGGACCGCCTCATCGCCCGTGCCACCTTGTGCTGT
--H--L--P--K--W--L--Q--T--W--D--F--L--P--R--W--M--H--S--L--Q--P--L--D--R--L--I--A--R--A--T--L--C--C-

----------------------------------------------------------------------------------------------------
-A--R--P--E--P--R--S--P--P--L--P--P--R--V--F--L--E--E--L--P--P--A--T--P--S--P--R--L--A--L--P--A--H--
GCCAGGCCTGAGCCCCGCTCACCCCCGCTGCCCCCCAGGGTCTTCCTGGAGGAGCTACCCCCTGCCACACCCTCCCCCCGTCTTGCACTGCCTGCTCACC
::::::::.:::::::::::::::::..::::. ::::.:::::::::::::::::.::::::::::::::::::::.::.::.::: ::::::::::.:
GCCAGGCCCGAGCCCCGCTCACCCCCATTGCCTACCAGAGTCTTCCTGGAGGAGCTGCCCCCTGCCACACCCTCCCCTCGCCTCGCAATGCCTGCTCATC
-A--R--P--E--P--R--S--P--P--L--P--T--R--V--F--L--E--E--L--P--P--A--T--P--S--P--R--L--A--M--P--A--H--

--------------------
H--N--A--T--R--L--*-
ACAATGCCACCCGCCTCTAG
 ::::::::::::.::::::
TCAATGCCACCCGTCTCTAG
L--N--A--T--R--L--*-

Pig Consensus Sequence

>BGISUST0000900038
ATGATGTCCTACGGAGAGAGGCTGGGGGGCCCGGCTATCTCCCCGCTCCCAGTCCGCGGGGGGCACATGATGCGTGGGGCGACCTTTGCCTACGTGCCCA
GCCCGCAG---CTGCACAGGATCCCAGGGACCTCAGCCTATGCCTTCCCCAGCCTGGGCCCTGTGGCCCTCACCGAGCACGGCTGCTCCTATGGGGAGGT
TCTGGAGCGCCATGACCCGCTGCCCTCCAAGCTGGCCCTGGAGGAGGAACAGAAGCCA---CCAGGGTTGGCCCAGAAGCTGCGCCAGGCTGGCTCAATG
CTCCTCAAGGTGCCGCTGATGCTTGCCTTCCTCTACCTCTTTGTCTGCTCCCTGGACGTGCTCAGCTCAGCCTTCCAGCTGGCTGGA---AAGGTGGCTG
GCGACATCTTCAAGGACAACGCCATCCTGTCCAACCCAGTAGCAGGGCTGGTGGTGGGGATCCTAGTGACCGTGCTGGTGCAGAGCTCCAGCACCTCCAC
ATCCATCATTGTCAGCATGGTCTCCTCTGGC---CTGGAGGTGAGCTCTGCCATCCCCATCATCATGGGCTCCAACATCGGCACCTCGGTCACCAACACC
ATCGTGGCCCTGATGCAGGCGGGGGACAGGACTGACTTCCGG---GCCTTCGCGGGGGCCACCGTGCACGACTGTTTTAACTGGCTCTCAGTTGTGGTCC
TGCTGCCCCTGGAAGCTGCCACCGGGTACCTGCACTACGTCACTCGACTTGTGGTAGCCTCCTTCAACATCCGTGGTGGCCGTGACACCCCTGACCTGCT
CAAGATCATCACGGAGCCTTTCACTAAGCTCATCATCCAG------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------AACCACATCTTCGTGGACACAGGGCTGCCTGACCTGGCCGTGGGGCTCATCCTGCTGGCTGGCTCCCTGGTACTCCTCTGCACCTGCCTCAT
CCTCCTCGTCAAGATGCTCAACTCTCTGCTCAAGGGCCAGGTGGCCAAGGTCATTCAGAAGGTTATCAAC------TTCCCTGCCCCCTTCACCTGggGC
TACTTTGCCATGGTGGTGGGCGCCGGCATGACTTTCGTCGTCCAGAGCAGTTCTGTGTTCACCTCGGCCATCACCCCACTC------CTAGGTGTAATCA
GCATCGAACGCGCCTACCCGCTCACACTGGGCTCCAACATCGGCACCACCACCACAGCCATCCTGGCGGCACTGGCCAGCCCCCGGGAGAAGCTGTCCAG
TGCTTTCCAGATCGCCCTCTGCCATTTCTTCTTCAACATCTCGGGCATCCTGCTGTGGTACCCAGTGCCCTGCATGCGCCTGCCCATCCGCATGGCCAAG
GCGCTGGGGAAACGTACCGCCAAATACCGCTGGTTCGCCGTCCTCTATCTCCTCCTGTGCTTCCTGCTGCTGCCCTCGCTGGTGTTTGGCATCTCCATGG
CAGGCTGGCAGGCCATGGTAGGTGTGGGCGCACCCTTCGGAGCCCTGCTGGCCTTTGTGGTACTTGTCAACATGCTGCAGAGCCGCAGCCCCGGGCACCT
GCCCAAGTGGCTACAGACTTGGGACTTCCTGCCTCGGTGGATGCACTCCCTGCAGCCCCTGGACCGCCTCATCGCCCGTGCCACCTTGTGCTGTGCCAGG
CCCGAGCCCCGCTCACCCCCATTGCCTACCAGAGTCTTCCTGGAGGAGCTGCCCCCTGCCACACCCTCCCCTCGCCTCGCAATGCCTGCTCATCTCAATG
CCACCCGTCTCTAG


>BGISUSP0000900038
MMSYGERLGGPAISPLPVRGGHMMRGATFAYVPSPQ-LHRIPGTSAYAFPSLGPVALTEHGCSYGEVLERHDPLPSKLALEEEQKP-PGLAQKLRQAGSM
LLKVPLMLAFLYLFVCSLDVLSSAFQLAG-KVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSG-LEVSSAIPIIMGSNIGTSVTNT
IVALMQAGDRTDFR-AFAGATVHDCFNWLSVVVLLPLEAATGYLHYVTRLVVASFNIRGGRDTPDLLKIITEPFTKLIIQ--------------------
------------------------------------NHIFVDTGLPDLAVGLILLAGSLVLLCTCLILLVKMLNSLLKGQVAKVIQKVIN--FPAPFTWG
YFAMVVGAGMTFVVQSSSVFTSAITPL--LGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQIALCHFFFNISGILLWYPVPCMRLPIRMAK
ALGKRTAKYRWFAVLYLLLCFLLLPSLVFGISMAGWQAMVGVGAPFGALLAFVVLVNMLQSRSPGHLPKWLQTWDFLPRWMHSLQPLDRLIARATLCCAR
PEPRSPPLPTRVFLEELPPATPSPRLAMPAHLNATRL*