Sequences
EST Library Info
csp2Spleen - RNA from China
lnt4Lymphatic nodule tracheobroncalis
Clusters
Oligos
SNPs

Gene ID ENSG00000177455 (click for geneview)
Transcript ID ENST00000324662(link to ensembl)
Symbol CD19
Localtion Chromosome:16:28850779:28858164:1 band: 16p11.2
Description B-lymphocyte antigen CD19 precursor (B-lymphocyte surface antigen B4) (Leu-12) (Differentiation antigen CD19). [Source:Uniprot/SWISSPROT;Acc:P15391]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------------------------------------><-----------
-M--P--P--P--R--L--L--F--F--L--L--F--L--T--P--M--E--V--R--P--E--E--P--L--V--V--K--V--E--E--G--D--N--
ATGCCACCTCCTCGCCTCCTCTTCTTCCTCCTCTTCCTCACCCCCATGGAAGTCAGGCCCGAGGAACCTCTAGTGGTGAAGGTGGAAGAGGGAGATAACG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--V--L--Q--C--L--K--G--T--S--D--G--P--T--Q--Q--L--T--W--S--R--E--S--P--L--K--P--F--L--K--L--S--L--G
CTGTGCTGCAGTGCCTCAAGGGGACCTCAGATGGCCCCACTCAGCAGCTGACCTGGTCTCGGGAGTCCCCGCTTAAACCCTTCTTAAAACTCAGCCTGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--P--G--L--G--I--H--M--R--P--L--A--I--W--L--F--I--F--N--V--S--Q--Q--M--G--G--F--Y--L--C--Q--P--G-
GCTGCCAGGCCTGGGAATCCACATGAGGCCCCTGGCCATCTGGCTTTTCATCTTCAACGTCTCTCAACAGATGGGGGGCTTCTACCTGTGCCAGCCGGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------><--------------------------------------------
-P--P--S--E--K--A--W--Q--P--G--W--T--V--N--V--E--G--S--G--E--L--F--R--W--N--V--S--D--L--G--G--L--G--
CCCCCCTCTGAGAAGGCCTGGCAGCCTGGCTGGACAGTCAATGTGGAGGGCAGCGGGGAGCTGTTCCGGTGGAATGTTTCGGACCTAGGTGGCCTGGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
C--G--L--K--N--R--S--S--E--G--P--S--S--P--S--G--K--L--M--S--P--K--L--Y--V--W--A--K--D--R--P--E--I--W
GTGGCCTGAAGAACAGGTCCTCAGAGGGCCCCAGCTCCCCTTCCGGGAAGCTCATGAGCCCCAAGCTGTATGTGTGGGCCAAAGACCGCCCTGAGATCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------><----------------------------------------
--E--G--E--P--P--C--L--P--P--R--D--S--L--N--Q--S--L--S--Q--D--L--T--M--A--P--G--S--T--L--W--L--S--C-
GGAGGGAGAGCCTCCGTGTCTCCCACCGAGGGACAGCCTGAACCAGAGCCTCAGCCAGGACCTCACCATGGCCCCTGGCTCCACACTCTGGCTGTCCTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--V--P--P--D--S--V--S--R--G--P--L--S--W--T--H--V--H--P--K--G--P--K--S--L--L--S--L--E--L--K--D--D--
GGGGTACCCCCTGACTCTGTGTCCAGGGGCCCCCTCTCCTGGACCCATGTGCACCCCAAGGGGCCTAAGTCATTGCTGAGCCTAGAGCTGAAGGACGATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--P--A--R--D--M--W--V--M--E--T--G--L--L--L--P--R--A--T--A--Q--D--A--G--K--Y--Y--C--H--R--G--N--L--T
GCCCGGCCAGAGATATGTGGGTAATGGAGACGGGTCTGTTGTTGCCCCGGGCCACAGCTCAAGACGCTGGAAAGTATTATTGTCACCGTGGCAACCTGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------><----------------------------------------------------------------
--M--S--F--H--L--E--I--T--A--R--P--V--L--W--H--W--L--L--R--T--G--G--W--K--V--S--A--V--T--L--A--Y--L-
CATGTCATTCCACCTGGAGATCACTGCTCGGCCAGTACTATGGCACTGGCTGCTGAGGACTGGTGGCTGGAAGGTCTCAGCTGTGACTTTGGCTTATCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------><-----------------------------------------------><----
-I--F--C--L--C--S--L--V--G--I--L--H--L--Q--R--A--L--V--L--R--R--K--R--K--R--M--T--D--P--T--R--R--F--
ATCTTCTGCCTGTGTTCCCTTGTGGGCATTCTTCATCTTCAAAGAGCCCTGGTCCTGAGGAGGAAAAGAAAGCGAATGACTGACCCCACCAGGAGATTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------------------------><---------------
F--K--V--T--P--P--P--G--S--G--P--Q--N--Q--Y--G--N--V--L--S--L--P--T--P--T--S--G--L--G--R--A--Q--R--W
TCAAAGTGACGCCTCCCCCAGGAAGCGGGCCCCAGAACCAGTACGGGAACGTGCTGTCTCTCCCCACACCCACCTCAGGCCTCGGACGCGCCCAGCGTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------------------><-
--A--A--G--L--G--G--T--A--P--S--Y--G--N--P--S--S--D--V--Q--A--D--G--A--L--G--S--R--S--P--P--G--V--G-
GGCCGCAGGCCTGGGGGGCACTGCCCCGTCTTATGGAAACCCGAGCAGCGACGTCCAGGCGGATGGAGCCTTGGGGTCCCGGAGCCCGCCGGGAGTGGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--E--E--E--E--G--E--G--Y--E--E--P--D--S--E--E--D--S--E--F--Y--E--N--D--S--N--L--G--Q--D--Q--L--S--
CCAGAAGAAGAGGAAGGGGAGGGCTATGAGGAACCTGACAGTGAGGAGGACTCCGAGTTCTATGAGAACGACTCCAACCTTGGGCAGGACCAGCTCTCCC
:::::::::::::::::::::: :::.:::::.:: :::::::::::.:.::::::::::::::::::::::::::::::.::::.:::.::::::::::
CCAGAAGAAGAGGAAGGGGAGGCCTACGAGGAGCCGGACAGTGAGGAAGGCTCCGAGTTCTATGAGAACGACTCCAACCTCGGGCGGGATCAGCTCTCCC
-P--E--E--E--E--G--E--A--Y--E--E--P--D--S--E--E--G--S--E--F--Y--E--N--D--S--N--L--G--R--D--Q--L--S--

--><-------------------------------------------------------------------><---------------------------
Q--D--G--S--G--Y--E--N--P--E--D--E--P--L--G--P--E--D--E--D--S--F--S--N--A--E--S--Y--E--N--E--D--E--E
AGGATGGCAGCGGCTACGAGAACCCTGAGGATGAGCCCCTGGGTCCTGAGGATGAAGACTCCTTCTCCAACGCTGAGTCTTATGAGAACGAGGATGAAGA
::   ::::::..::::::.::::::::::: :.: .:.::::::::::::::::::::::::::::::::   ::::::::::::::.:::::::::::
AG---GGCAGCAACTACGAAAACCCTGAGGAGGGGGTCTTGGGTCCTGAGGATGAAGACTCCTTCTCCAAC---GAGTCTTATGAGAATGAGGATGAAGA
Q-----G--S--N--Y--E--N--P--E--E--G--V--L--G--P--E--D--E--D--S--F--S--N-----E--S--Y--E--N--E--D--E--E

----------------------------><-------------------------------------------------------><-------------
--L--T--Q--P--V--A--R--T--M--D--F--L--S--P--H--G--S--A--W--D--P--S--R--E--A--T--S--L--G--S--Q--S--Y-
GCTGACCCAGCCGGTCGCCAGGACAATGGACTTCCTGAGCCCTCATGGGTCAGCCTGGGACCCCAGCCGGGAAGCAACCTCCCTGGGGTCCCAGTCCTAT
:.::..:::::::::.::::::::.      :::::::::::.:::::::::::::::::::::::: ::::.:::::::::      ::::::::::::
GTTGGTCCAGCCGGTTGCCAGGACG------TTCCTGAGCCCCCATGGGTCAGCCTGGGACCCCAGCAGGGAGGCAACCTCC------TCCCAGTCCTAT
--L--V--Q--P--V--A--R--T--------F--L--S--P--H--G--S--A--W--D--P--S--R--E--A--T--S--------S--Q--S--Y-

------------------------------------------------------------------------------><--------------------
-E--D--M--R--G--I--L--Y--A--A--P--Q--L--R--S--I--R--G--Q--P--G--P--N--H--E--E--D--A--D--S--Y--E--N--
GAGGATATGAGAGGAATCCTGTATGCAGCCCCCCAGCTCCGCTCCATTCGGGGCCAGCCTGGACCCAATCATGAGGAAGATGCAGACTCTTATGAGAACA
::.:::::::::::.:::::::::::::::::::::::::::::: ::::.::::::::::: :::::.::.::::::   ::.::::::::::::::.:
GAAGATATGAGAGGGATCCTGTATGCAGCCCCCCAGCTCCGCTCCTTTCGAGGCCAGCCTGGTCCCAACCACGAGGAA---GCGGACTCTTATGAGAATA
-E--D--M--R--G--I--L--Y--A--A--P--Q--L--R--S--F--R--G--Q--P--G--P--N--H--E--E-----A--D--S--Y--E--N--

---------------------------------------------------------------------->
M--D--N--P--D--G--P--D--P--A--W--G--G--G--G--R--M--G--T--W--S--T--R--*-
TGGATAATCCCGATGGGCCAGACCCAGCCTGGGGAGGAGGGGGCCGCATGGGCACCTGGAGCACCAGGTGA
::::::::::.::::::::::: ::::: ::::::::::::::::.:::::::.::::::::::.::::::
TGGATAATCCTGATGGGCCAGAACCAGCATGGGGAGGAGGGGGCCACATGGGCGCCTGGAGCACTAGGTGA
M--D--N--P--D--G--P--E--P--A--W--G--G--G--G--H--M--G--A--W--S--T--R--*-

Pig Consensus Sequence

>BGISUST0000895041
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
CCAGAAGAAGAGGAAGGGGAGGCCTACGAGGAGCCGGACAGTGAGGAAGGCTCCGAGTTCTATGAGAACGACTCCAACCTCGGGCGGGATCAGCTCTCCC
AG---GGCAGCAACTACGAAAACCCTGAGGAGGGGGTCTTGGGTCCTGAGGATGAAGACTCCTTCTCCAAC---GAGTCTTATGAGAATGAGGATGAAGA
GTTGGTCCAGCCGGTTGCCAGGACG------TTCCTGAGCCCCCATGGGTCAGCCTGGGACCCCAGCAGGGAGGCAACCTCC------TCCCAGTCCTAT
GAAGATATGAGAGGGATCCTGTATGCAGCCCCCCAGCTCCGCTCCTTTCGAGGCCAGCCTGGTCCCAACCACGAGGAA---GCGGACTCTTATGAGAATA
TGGATAATCCTGATGGGCCAGAACCAGCATGGGGAGGAGGGGGCCACATGGGCGCCTGGAGCACTAGGTGA


>BGISUSP0000895041
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
PEEEEGEAYEEPDSEEGSEFYENDSNLGRDQLSQ-GSNYENPEEGVLGPEDEDSFSN-ESYENEDEELVQPVART--FLSPHGSAWDPSREATS--SQSY
EDMRGILYAAPQLRSFRGQPGPNHEE-ADSYENMDNPDGPEPAWGGGGHMGAWSTR*