Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000177519 (click for geneview)
Transcript ID ENST00000325926(link to ensembl)
Symbol RPRM
Localtion Chromosome:2:154160258:154160587:-1 band: 2q23.3
Description reprimo, TP53 dependant G2 arrest mediator candidate [Source:RefSeq_peptide;Acc:NP_062819]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--N--P--A--L--G--N--Q--T--D--V--A--G--L--F--L--A--N--S--S--E--A--L--E--R--A--V--R--C--C--T--Q--A--
ATGAATCCGGCCCTAGGCAACCAGACGGACGTGGCGGGCCTGTTCCTGGCCAACAGCAGCGAGGCGCTGGAGCGAGCCGTGCGCTGCTGCACCCAGGCGT
::::::::.:::::.::::::::::: ::.:::::.::.::::::::::::::::::::::::::::::::::: :: ::::::::::::::::::::::
ATGAATCCAGCCCTGGGCAACCAGACTGATGTGGCAGGTCTGTTCCTGGCCAACAGCAGCGAGGCGCTGGAGCGCGCGGTGCGCTGCTGCACCCAGGCGT
-M--N--P--A--L--G--N--Q--T--D--V--A--G--L--F--L--A--N--S--S--E--A--L--E--R--A--V--R--C--C--T--Q--A--

----------------------------------------------------------------------------------------------------
S--V--V--T--D--D--G--F--A--E--G--G--P--D--E--R--S--L--Y--I--M--R--V--V--Q--I--A--V--M--C--V--L--S--L
CCGTGGTGACCGACGACGGCTTCGCGGAGGGAGGCCCGGACGAGCGTAGCCTGTACATAATGCGCGTGGTGCAGATCGCGGTCATGTGCGTGCTCTCACT
::::::::::::::::::::::::::::::: ::::::::::::::.::::::::::: ::::: :::::::::::::: :::::::::::::::::.::
CCGTGGTGACCGACGACGGCTTCGCGGAGGGCGGCCCGGACGAGCGCAGCCTGTACATCATGCGAGTGGTGCAGATCGCCGTCATGTGCGTGCTCTCGCT
S--V--V--T--D--D--G--F--A--E--G--G--P--D--E--R--S--L--Y--I--M--R--V--V--Q--I--A--V--M--C--V--L--S--L

----------------------------------------------------------------------------------------------------
--T--V--V--F--G--I--F--F--L--G--C--N--L--L--I--K--S--E--G--M--I--N--F--L--V--K--D--R--R--P--S--K--E-
CACCGTGGTCTTCGGCATCTTCTTCCTCGGCTGCAATCTGCTCATCAAGTCCGAGGGCATGATCAACTTCCTCGTGAAGGACCGGAGGCCGTCTAAGGAG
::::::::::::.::::::::::::::.::::::::.:: :::::::::::::::::::::::::::::::: ::::::::::::::.::::::::::::
CACCGTGGTCTTTGGCATCTTCTTCCTTGGCTGCAACCTCCTCATCAAGTCCGAGGGCATGATCAACTTCCTGGTGAAGGACCGGAGACCGTCTAAGGAG
--T--V--V--F--G--I--F--F--L--G--C--N--L--L--I--K--S--E--G--M--I--N--F--L--V--K--D--R--R--P--S--K--E-

----------------------------->
-V--E--A--V--V--V--G--P--Y--*-
GTGGAGGCGGTGGTCGTGGGGCCCTACTGA
::::::::.:::::::::::::::::::::
GTGGAGGCAGTGGTCGTGGGGCCCTACTGA
-V--E--A--V--V--V--G--P--Y--*-

Pig Consensus Sequence

>BGISUST0000896984
ATGAATCCAGCCCTGGGCAACCAGACTGATGTGGCAGGTCTGTTCCTGGCCAACAGCAGCGAGGCGCTGGAGCGCGCGGTGCGCTGCTGCACCCAGGCGT
CCGTGGTGACCGACGACGGCTTCGCGGAGGGCGGCCCGGACGAGCGCAGCCTGTACATCATGCGAGTGGTGCAGATCGCCGTCATGTGCGTGCTCTCGCT
CACCGTGGTCTTTGGCATCTTCTTCCTTGGCTGCAACCTCCTCATCAAGTCCGAGGGCATGATCAACTTCCTGGTGAAGGACCGGAGACCGTCTAAGGAG
GTGGAGGCAGTGGTCGTGGGGCCCTACTGA


>BGISUSP0000896984
MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKE
VEAVVVGPY*