Sequences
EST Library Info
jej2Small intestine, jejunum
med1Mediastinum
nmm3Newborn 115 days, mucosal membranes
Clusters
Oligos
SNPs

Gene ID ENSG00000176853 (click for geneview)
Transcript ID ENST00000325963(link to ensembl)
Symbol NP_659400.1
Localtion Chromosome:8:124860078:124894257:1 band: 8q24.13
Description hypothetical protein FLJ23790
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------------------------------------><---------------
-M--N--R--V--Q--G--D--Y--F--E--T--L--L--Y--K--I--F--V--S--I--D--E--H--T--N--V--A--E--L--A--N--V--L--
ATGAATCGAGTGCAAGGTGATTATTTTGAAACTCTACTCTATAAGATATTTGTTTCAATAGATGAGCACACAAATGTTGCAGAGCTTGCAAATGTCCTTG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:: ::::::::::::                
ATGAATCGAGTGCAAGGTGATTATTTTGAAACTCTACTCTATAAGATATTTGTTTCAATAGATGAGCATACTAATGTTGCAGAG----------------
-M--N--R--V--Q--G--D--Y--F--E--T--L--L--Y--K--I--F--V--S--I--D--E--H--T--N--V--A--E-----------------

----------------------><----------------------------------------------------------------------------
E--I--D--L--S--L--V--K--N--A--V--S--M--Y--C--R--L--G--F--A--H--K--K--G--Q--V--I--N--L--D--Q--L--H--S
AGATTGACTTATCCCTGGTTAAGAATGCTGTTTCAATGTATTGCCGATTGGGCTTTGCCCATAAGAAGGGACAAGTAATTAATTTGGATCAACTTCATTC
                       :::::. : ::::::::.::: ::::::: :::::::::::::::::::::::::: ::::::::::::::::::::
-----------------------AATGCCCTGTCAATGTACTGCAGATTGGGATTTGCCCATAAGAAGGGACAAGTAATAAATTTGGATCAACTTCATTC
------------------------N--A--L--S--M--Y--C--R--L--G--F--A--H--K--K--G--Q--V--I--N--L--D--Q--L--H--S

-----------------------------------><---------------------------------------------------------------
--S--W--K--N--V--P--S--V--N--R--L--K--S--T--L--D--P--Q--K--M--L--L--S--W--D--G--G--E--S--R--S--P--V-
ATCATGGAAGAATGTTCCATCCGTAAACAGATTAAAGAGTACCTTAGATCCACAGAAGATGCTCTTGTCATGGGATGGAGGGGAAAGTAGGAGTCCTGTA
:::.::::::::::: :::::.::::::::::::   :::::.:::::::::::.:::::::: .: ::::::::::: ::::::::::::::::: :::
ATCGTGGAAGAATGTACCATCTGTAAACAGATTA---AGTACTTTAGATCCACAAAAGATGCTGCTTTCATGGGATGGTGGGGAAAGTAGGAGTCCGGTA
--S--W--K--N--V--P--S--V--N--R--L-----S--T--L--D--P--Q--K--M--L--L--S--W--D--G--G--E--S--R--S--P--V-

---------------------------------------------------><-----------------------------------------------
-Q--E--A--S--S--A--T--D--T--D--T--N--S--Q--E--D--P--A--D--T--A--S--V--S--S--L--S--L--S--T--G--H--T--
CAAGAAGCTTCATCGGCAACTGACACTGATACAAATAGTCAAGAAGATCCAGCTGACACAGCCAGTGTAAGCAGCCTGAGTCTGTCTACAGGACACACGA
::::::::::::::.:: ::::::::::::::::::::::::::::::      :::::::::::: :::::::..::::..:::::::::::.:.::.:
CAAGAAGCTTCATCAGCTACTGACACTGATACAAATAGTCAAGAAGAT------GACACAGCCAGTTTAAGCAGTTTGAGCTTGTCTACAGGATATACAA
-Q--E--A--S--S--A--T--D--T--D--T--N--S--Q--E--D--------D--T--A--S--L--S--S--L--S--L--S--T--G--Y--T--

----------------------------------------------------------------><----------------------------------
K--R--I--A--F--L--F--D--S--T--L--T--A--F--L--M--M--G--N--L--S--P--N--L--K--S--H--A--V--T--M--F--E--V
AGCGCATCGCATTCCTGTTTGACTCCACTCTTACTGCCTTCTTAATGATGGGAAATCTTTCACCAAACTTGAAAAGTCATGCAGTCACAATGTTTGAAGT
::::.::::::::::: :::::::: ::::::::::::::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::
AGCGTATCGCATTCCTTTTTGACTCAACTCTTACTGCCTTTTTAATGATGGGAAATCTTTCACCAAACTTGAAAAGCCATGCAGTCACAATGTTTGAAGT
K--R--I--A--F--L--F--D--S--T--L--T--A--F--L--M--M--G--N--L--S--P--N--L--K--S--H--A--V--T--M--F--E--V

---------------------------------------------------><-----------------------------------------------
--G--K--L--S--D--E--S--L--D--S--F--L--I--E--L--E--K--V--Q--S--T--G--E--G--E--A--Q--R--Y--F--D--H--A-
AGGCAAACTCTCAGATGAGTCTCTGGACAGCTTTCTTATAGAACTAGAAAAGGTTCAGAGCACTGGTGAAGGAGAAGCACAGAGATATTTTGATCATGCA
 :::::::::::::: :::::::::::::::::::::::::::::::::::::::.:.::::::::::::::::::::::::::::::::::::::::::
TGGCAAACTCTCAGAAGAGTCTCTGGACAGCTTTCTTATAGAACTAGAAAAGGTTTAAAGCACTGGTGAAGGAGAAGCACAGAGATATTTTGATCATGCA
--G--K--L--S--E--E--S--L--D--S--F--L--I--E--L--E--K--V--*--S--T--G--E--G--E--A--Q--R--Y--F--D--H--A-

------------------------------------------------------------------------------------><--------------
-L--T--L--R--N--T--I--L--F--L--R--H--N--K--D--L--V--A--Q--T--A--Q--P--D--Q--P--N--Y--G--F--P--L--D--
CTTACTCTGAGAAACACAATACTGTTTCTGCGTCATAACAAAGATCTAGTTGCGCAAACTGCACAGCCAGACCAACCCAATTATGGTTTTCCTCTGGATC
:::::::::::::::::::::.::::::::::::::::.::::::::::::::.::::::::::::::::::::::::::::::   :::.:::::::::
CTTACTCTGAGAAACACAATATTGTTTCTGCGTCATAATAAAGATCTAGTTGCACAAACTGCACAGCCAGACCAACCCAATTAT---TTTTCTCTGGATC
-L--T--L--R--N--T--I--L--F--L--R--H--N--K--D--L--V--A--Q--T--A--Q--P--D--Q--P--N--Y-----F--S--L--D--

----------------------------------------------------------------------------------------------------
L--L--R--C--E--S--L--L--G--L--D--P--A--T--C--S--R--V--L--N--K--N--Y--T--L--L--V--S--M--A--P--L--T--N
TCTTACGCTGTGAAAGCCTTCTTGGTTTGGACCCTGCAACTTGCAGCAGAGTTCTAAACAAAAATTACACGCTGCTTGTTTCCATGGCTCCCCTCACCAA
::::.:.::::::::::::::: :: :::::::::::::::::::::::::::::::::::::::::::: ::::::::.:::::::::::.::.:::::
TCTTGCACTGTGAAAGCCTTCTGGGATTGGACCCTGCAACTTGCAGCAGAGTTCTAAACAAAAATTACACCCTGCTTGTCTCCATGGCTCCTCTTACCAA
L--L--H--C--E--S--L--L--G--L--D--P--A--T--C--S--R--V--L--N--K--N--Y--T--L--L--V--S--M--A--P--L--T--N

---------------------------------><-----------------------------------------------------------------
--E--I--R--P--V--S--S--C--T--P--Q--H--I--G--P--A--I--P--E--V--S--S--V--W--F--K--L--Y--I--Y--H--V--T-
TGAAATCCGGCCTGTCAGCAGCTGCACCCCTCAGCATATTGGACCAGCTATCCCAGAAGTCAGCTCTGTCTGGTTTAAACTGTACATTTATCATGTCACT
:::::: :::::::::::::::::::: :::::::::::::::::::: ::::::::::::::.::::::::::::::.:::::::::::.::..::::.
TGAAATACGGCCTGTCAGCAGCTGCACACCTCAGCATATTGGACCAGCAATCCCAGAAGTCAGTTCTGTCTGGTTTAAGCTGTACATTTACCACATCACC
--E--I--R--P--V--S--S--C--T--P--Q--H--I--G--P--A--I--P--E--V--S--S--V--W--F--K--L--Y--I--Y--H--I--T-

--------------------------------------------------------------------><------------------------------
-G--Q--G--P--P--S--L--L--L--S--K--G--T--R--L--R--K--L--P--D--I--F--Q--S--Y--D--R--L--L--I--T--S--W--
GGACAAGGACCACCATCCCTTTTATTGTCCAAAGGTACAAGACTTCGAAAACTGCCAGATATATTTCAGAGTTATGATCGATTGCTAATAACATCTTGGG
.:.::.:::::::: ::.::::::.::::::::::::::::::::::::::::::::::::::::.:::   ::.::::::::.::::::::.:: ::::
AGGCAGGGACCACCTTCTCTTTTACTGTCCAAAGGTACAAGACTTCGAAAACTGCCAGATATATTCCAG---TACGATCGATTACTAATAACGTCGTGGG
-R--Q--G--P--P--S--L--L--L--S--K--G--T--R--L--R--K--L--P--D--I--F--Q-----Y--D--R--L--L--I--T--S--W--

----------------------------------------------------------------------------------><----------------
G--H--D--P--G--V--V--P--T--S--N--V--L--T--M--L--N--D--A--L--T--H--S--A--V--L--I--Q--G--H--G--L--H--G
GTCATGATCCTGGAGTAGTTCCTACCTCAAATGTGCTCACGATGTTGAATGATGCTTTAACACATTCTGCAGTTTTAATTCAGGGGCATGGTCTGCATGG
:::::::::::::.::.:::::::: ::.:::::::::::.:::::::::::::::::::::::::: :: :::.:.:::::::::::::::::::::::
GTCATGATCCTGGGGTGGTTCCTACATCGAATGTGCTCACAATGTTGAATGATGCTTTAACACATTCGGCCGTTCTGATTCAGGGGCATGGTCTGCATGG
G--H--D--P--G--V--V--P--T--S--N--V--L--T--M--L--N--D--A--L--T--H--S--A--V--L--I--Q--G--H--G--L--H--G

-------------------------------------------------------><-------------------------------------------
--I--G--E--T--V--H--V--P--F--P--F--D--E--T--E--L--Q--G--E--F--T--R--V--N--M--G--V--H--K--A--L--Q--I-
GATAGGAGAAACTGTCCATGTCCCATTTCCATTTGATGAAACAGAACTACAAGGAGAGTTCACTCGTGTCAATATGGGTGTTCATAAAGCATTGCAGATA
:::::::::.::::::::..: :: ::.:::::::::::.:::::::: ::::::   ::.:::.::::.:::::::::::.::::::::: ::::.:::
GATAGGAGAGACTGTCCACATACCTTTCCCATTTGATGAGACAGAACTCCAAGGA---TTTACTTGTGTTAATATGGGTGTCCATAAAGCAGTGCAAATA
--I--G--E--T--V--H--I--P--F--P--F--D--E--T--E--L--Q--G-----F--T--C--V--N--M--G--V--H--K--A--V--Q--I-

----------------------------------------------------------------------------------------------------
-L--R--N--R--V--D--L--Q--H--L--C--G--Y--V--T--M--L--N--A--S--S--Q--L--A--D--R--K--L--S--D--A--S--D--
CTAAGGAACAGAGTGGACTTACAGCATCTCTGTGGATATGTCACCATGTTGAATGCTTCCAGCCAACTTGCAGATAGAAAACTCAGTGATGCTTCTGATG
.:::::::::.:::::::::.::::::.:.:::::::::::::::::::::::::::::::::::.::::::.:.:::::::::::::::::::::::::
TTAAGGAACAAAGTGGACTTGCAGCATTTTTGTGGATATGTCACCATGTTGAATGCTTCCAGCCAGCTTGCAAACAGAAAACTCAGTGATGCTTCTGATG
-L--R--N--K--V--D--L--Q--H--F--C--G--Y--V--T--M--L--N--A--S--S--Q--L--A--N--R--K--L--S--D--A--S--D--

-----><---------------------------------------------------------------------------------------------
E--R--G--E--P--D--L--A--S--G--S--D--V--N--G--S--T--E--S--F--E--M--V--I--E--E--A--T--I--D--S--A--T--K
AGAGAGGAGAACCTGATTTGGCTTCTGGCTCAGATGTAAATGGGAGTACAGAGTCATTTGAAATGGTCATTGAGGAAGCAACTATAGATTCAGCAACAAA
:::::   :::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::.::.:::::::::: :::::
AGAGA---GAACCTGATTTGGCTTCTGGCTCAGATGTAAATGGGAGTACGGAGTCATTTGAAATGGTCATTGAGGAAGCAGCTGTAGATTCAGCCACAAA
E--R-----E--P--D--L--A--S--G--S--D--V--N--G--S--T--E--S--F--E--M--V--I--E--E--A--A--V--D--S--A--T--K

----------><----------------------------------------------------------------------------------------
--Q--T--S--G--A--T--T--E--A--D--W--V--P--L--E--L--C--F--G--I--P--L--F--S--S--E--L--N--R--K--V--C--R-
GCAAACCTCTGGTGCCACAACAGAAGCAGATTGGGTTCCTCTCGAGCTGTGCTTTGGAATTCCACTGTTCAGTTCCGAATTAAACCGGAAAGTTTGTAGG
::::: ::::   :::::::::::::::::: :::::::::::::::::::::: :::::::::::.::.:::::.::::::::.:.:::::::::.::.
GCAAAACTCT---GCCACAACAGAAGCAGATGGGGTTCCTCTCGAGCTGTGCTTGGGAATTCCACTATTTAGTTCTGAATTAAATCAGAAAGTTTGCAGA
--Q--N--S-----A--T--T--E--A--D--G--V--P--L--E--L--C--L--G--I--P--L--F--S--S--E--L--N--Q--K--V--C--R-

----------------------------------><----------------------------------------------------------------
-K--I--A--A--H--G--L--C--R--K--E--S--L--Q--N--L--L--H--S--S--R--K--L--S--L--Q--V--L--N--F--V--H--S--
AAAATTGCTGCACATGGCCTTTGCAGAAAAGAGAGCCTTCAAAACCTCTTACATTCCAGTAGAAAACTCTCTCTGCAAGTCCTTAACTTTGTTCACTCAT
::.::::::.: :::::::::::::::::::::   :::::::::::::::::::::::::::::::: :::::.:::::::::::::::::::::::::
AAGATTGCTACTCATGGCCTTTGCAGAAAAGAG---CTTCAAAACCTCTTACATTCCAGTAGAAAACTATCTCTACAAGTCCTTAACTTTGTTCACTCAT
-K--I--A--T--H--G--L--C--R--K--E-----L--Q--N--L--L--H--S--S--R--K--L--S--L--Q--V--L--N--F--V--H--S--

----><----------------------------------------------------------------------------------------------
F--Q--E--G--A--S--I--L--D--I--H--T--E--P--S--F--S--S--L--L--S--Q--S--S--C--A--D--M--G--V--P--L--P--A
TCCAGGAAGGTGCTTCAATATTGGATATTCACACAGAGCCCAGTTTTTCAAGTTTGCTTTCACAGTCATCGTGTGCTGACATGGGTGTTCCACTTCCTGC
::::::::.:::::::: .:.:::::::.::::: ::: :::::::::::.::::::::::::::::::: :::::.:::.:::: ::::::::::::::
TCCAGGAAAGTGCTTCACCACTGGATATCCACACTGAGGCCAGTTTTTCAGGTTTGCTTTCACAGTCATCCTGTGCCGACGTGGGAGTTCCACTTCCTGC
F--Q--E--S--A--S--P--L--D--I--H--T--E--A--S--F--S--G--L--L--S--Q--S--S--C--A--D--V--G--V--P--L--P--A

------------------------------------------------------------------------------------------>
--K--N--L--I--F--K--D--G--V--L--S--E--W--S--G--R--S--P--S--S--L--L--I--A--N--L--H--L--Q--*-
AAAAAACTTAATATTTAAAGATGGTGTCTTATCAGAATGGAGTGGACGGTCACCTTCCTCACTTCTTATTGCTAATCTCCATTTGCAATAA
:::.::::::::::::::::::::..::::: :::::::::::::::::::.::::::::.:::::. :::::::::::::: ::::::::
AAAGAACTTAATATTTAAAGATGGCATCTTAACAGAATGGAGTGGACGGTCGCCTTCCTCGCTTCTCCTTGCTAATCTCCATATGCAATAA
--K--N--L--I--F--K--D--G--I--L--T--E--W--S--G--R--S--P--S--S--L--L--L--A--N--L--H--M--Q--*-

Pig Consensus Sequence

>BGISUST0000884695
ATGAATCGAGTGCAAGGTGATTATTTTGAAACTCTACTCTATAAGATATTTGTTTCAATAGATGAGCATACTAATGTTGCAGAG----------------
-----------------------AATGCCCTGTCAATGTACTGCAGATTGGGATTTGCCCATAAGAAGGGACAAGTAATAAATTTGGATCAACTTCATTC
ATCGTGGAAGAATGTACCATCTGTAAACAGATTA---AGTACTTTAGATCCACAAAAGATGCTGCTTTCATGGGATGGTGGGGAAAGTAGGAGTCCGGTA
CAAGAAGCTTCATCAGCTACTGACACTGATACAAATAGTCAAGAAGAT------GACACAGCCAGTTTAAGCAGTTTGAGCTTGTCTACAGGATATACAA
AGCGTATCGCATTCCTTTTTGACTCAACTCTTACTGCCTTTTTAATGATGGGAAATCTTTCACCAAACTTGAAAAGCCATGCAGTCACAATGTTTGAAGT
TGGCAAACTCTCAGAAGAGTCTCTGGACAGCTTTCTTATAGAACTAGAAAAGGTTTAAAGCACTGGTGAAGGAGAAGCACAGAGATATTTTGATCATGCA
CTTACTCTGAGAAACACAATATTGTTTCTGCGTCATAATAAAGATCTAGTTGCACAAACTGCACAGCCAGACCAACCCAATTAT---TTTTCTCTGGATC
TCTTGCACTGTGAAAGCCTTCTGGGATTGGACCCTGCAACTTGCAGCAGAGTTCTAAACAAAAATTACACCCTGCTTGTCTCCATGGCTCCTCTTACCAA
TGAAATACGGCCTGTCAGCAGCTGCACACCTCAGCATATTGGACCAGCAATCCCAGAAGTCAGTTCTGTCTGGTTTAAGCTGTACATTTACCACATCACC
AGGCAGGGACCACCTTCTCTTTTACTGTCCAAAGGTACAAGACTTCGAAAACTGCCAGATATATTCCAG---TACGATCGATTACTAATAACGTCGTGGG
GTCATGATCCTGGGGTGGTTCCTACATCGAATGTGCTCACAATGTTGAATGATGCTTTAACACATTCGGCCGTTCTGATTCAGGGGCATGGTCTGCATGG
GATAGGAGAGACTGTCCACATACCTTTCCCATTTGATGAGACAGAACTCCAAGGA---TTTACTTGTGTTAATATGGGTGTCCATAAAGCAGTGCAAATA
TTAAGGAACAAAGTGGACTTGCAGCATTTTTGTGGATATGTCACCATGTTGAATGCTTCCAGCCAGCTTGCAAACAGAAAACTCAGTGATGCTTCTGATG
AGAGA---GAACCTGATTTGGCTTCTGGCTCAGATGTAAATGGGAGTACGGAGTCATTTGAAATGGTCATTGAGGAAGCAGCTGTAGATTCAGCCACAAA
GCAAAACTCT---GCCACAACAGAAGCAGATGGGGTTCCTCTCGAGCTGTGCTTGGGAATTCCACTATTTAGTTCTGAATTAAATCAGAAAGTTTGCAGA
AAGATTGCTACTCATGGCCTTTGCAGAAAAGAG---CTTCAAAACCTCTTACATTCCAGTAGAAAACTATCTCTACAAGTCCTTAACTTTGTTCACTCAT
TCCAGGAAAGTGCTTCACCACTGGATATCCACACTGAGGCCAGTTTTTCAGGTTTGCTTTCACAGTCATCCTGTGCCGACGTGGGAGTTCCACTTCCTGC
AAAGAACTTAATATTTAAAGATGGCATCTTAACAGAATGGAGTGGACGGTCGCCTTCCTCGCTTCTCCTTGCTAATCTCCATATGCAATAA


>BGISUSP0000884695
MNRVQGDYFETLLYKIFVSIDEHTNVAE-------------NALSMYCRLGFAHKKGQVINLDQLHSSWKNVPSVNRL-STLDPQKMLLSWDGGESRSPV
QEASSATDTDTNSQED--DTASLSSLSLSTGYTKRIAFLFDSTLTAFLMMGNLSPNLKSHAVTMFEVGKLSEESLDSFLIELEKV*STGEGEAQRYFDHA
LTLRNTILFLRHNKDLVAQTAQPDQPNY-FSLDLLHCESLLGLDPATCSRVLNKNYTLLVSMAPLTNEIRPVSSCTPQHIGPAIPEVSSVWFKLYIYHIT
RQGPPSLLLSKGTRLRKLPDIFQ-YDRLLITSWGHDPGVVPTSNVLTMLNDALTHSAVLIQGHGLHGIGETVHIPFPFDETELQG-FTCVNMGVHKAVQI
LRNKVDLQHFCGYVTMLNASSQLANRKLSDASDER-EPDLASGSDVNGSTESFEMVIEEAAVDSATKQNS-ATTEADGVPLELCLGIPLFSSELNQKVCR
KIATHGLCRKE-LQNLLHSSRKLSLQVLNFVHSFQESASPLDIHTEASFSGLLSQSSCADVGVPLPAKNLIFKDGILTEWSGRSPSSLLLANLHMQ*