Sequences
EST Library Info
che2Heart - RNA from China
cje1Jejunum - RNA from China
eep1Foetus 50 days, epidermis
nco2Newborn 115 days, colon
plac1Unavailable
pldo1Unavailable
plun1Unavailable
spl2Spleen
ssp1M. Supraspinatus
ste2M. Semitendinosus
ton1Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000180408 (click for geneview)
Transcript ID ENST00000326140(link to ensembl)
Symbol Q9BRT5_HUMAN
Localtion Chromosome:4:25592088:25607702:1 band: 4p15.2
Description PREDICTED: hypothetical protein XP_371691
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-P--G--S--E--S--L--S--T--S--S--E--R--G--H--G--P--A--V--G--N--L--V--S--E--S--A--G--R--S--A--G--Q--G--
CCCGGAAGCGAAAGCCTCTCCACCTCTTCCGAGCGGGGTCACGGCCCGGCCGTCGGTAACCTGGTTTCCGAGAGTGCCGGGCGGTCGGCGGGTCAGGGCA
:::::::::.:::::: .:.: :: ::::: ::: ::::::::.:::.:: : :.: :.:: :: :::::::::. : : :.  ::.::::::::: : :
CCCGGAAGCAAAAGCCGTTTCTCCACTTCCCAGCCGGGTCACGACCCAGCGGGCAGGAGCCAGGATTCCGAGAGCTCGGTGTCCTCAGCGGGTCAGCGAA
-P--G--S--K--S--R--F--S--T--S--Q--P--G--H--D--P--A--G--R--S--Q--D--S--E--S--S--V--S--S--A--G--Q--R--

----------------------------------------------------------------------------------------------------
S--P--G--P--D--A--M--S--R--N--L--R--T--A--L--I--F--G--G--F--I--S--L--I--G--A--A--F--Y--P--I--Y--F--R
GCCCGGGGCCTGACGCCATGTCCCGGAACCTGCGCACCGCGCTCATTTTCGGCGGCTTCATCTCCCTGATCGGCGCCGCCTTCTATCCCATCTACTTCCG
: :: :: .: :: :::::::::  :::.::::::::::::::::::::.::.::::::::: ::::::::::::::::::::::.::::::::::::::
GGCCCGGTTCAGA-GCCATGTCCACGAATCTGCGCACCGCGCTCATTTTTGGTGGCTTCATCACCCTGATCGGCGCCGCCTTCTACCCCATCTACTTCCG
R--P--G--S--D--A--M--S--T--N--L--R--T--A--L--I--F--G--G--F--I--T--L--I--G--A--A--F--Y--P--I--Y--F--R

----------------------------><-------------------------------------------------------><-------------
--P--L--M--R--L--E--E--Y--K--K--E--Q--A--I--N--R--A--G--I--V--Q--E--D--V--Q--P--P--G--L--K--V--W--S-
GCCCCTAATGAGATTGGAGGAGTACAAGAAGGAACAAGCTATAAATCGGGCTGGAATTGTTCAAGAGGATGTGCAGCCACCAGGGTTAAAAGTGTGGTCT
:::::::::: :..:::::::::::   :::::.::.:::.:::::::.::::: ::.::.::.::.:::::::::::::::   ::.::::::::::::
GCCCCTAATGCGGCTGGAGGAGTAC---AAGGAGCAGGCTGTAAATCGAGCTGGTATCGTCCAGGAAGATGTGCAGCCACCA---TTGAAAGTGTGGTCT
--P--L--M--R--L--E--E--Y-----K--E--Q--A--V--N--R--A--G--I--V--Q--E--D--V--Q--P--P-----L--K--V--W--S-

---------------------
-D--P--F--G--R--K--*-
GATCCATTTGGCAGGAAATGA
:::::.:::::::::::::::
GATCCGTTTGGCAGGAAATGA
-D--P--F--G--R--K--*-

Pig Consensus Sequence

>BGISUST0000886417
CCCGGAAGCAAAAGCCGTTTCTCCACTTCCCAGCCGGGTCACGACCCAGCGGGCAGGAGCCAGGATTCCGAGAGCTCGGTGTCCTCAGCGGGTCAGCGAA
GGCCCGGTTCagCCATGTCCACGAATCTGCGCACCGCGCTCATTTTTGGTGGCTTCATCACCCTGATCGGCGCCGCCTTCTACCCCATCTACTTCCGGCC
CCTAATGCGGCTGGAGGAGTAC---AAGGAGCAGGCTGTAAATCGAGCTGGTATCGTCCAGGAAGATGTGCAGCCACCA---TTGAAAGTGTGGTCTGAT
CCGTTTGGCAGGAAATGA


>BGISUSP0000886417
PGSKSRFSTSQPGHDPAGRSQDSESSVSSAGQRRPGSAMSTNLRTALIFGGFITLIGAAFYPIYFRPLMRLEEY-KEQAVNRAGIVQEDVQPP-LKVWSD
PFGRK*