Sequences
EST Library Info
cov2Ovary - RNA from China
eje1Foetus 50 days, jejunum
hyp2Hypothalamus
Clusters
Oligos
SNPs

Gene ID ENSG00000177465 (click for geneview)
Transcript ID ENST00000326303(link to ensembl)
Symbol PTE2B_HUMAN
Localtion Chromosome:14:73128394:73132221:1 band: 14q24.3
Description Peroxisomal acyl coenzyme A thioester hydrolase Ib (EC 3.1.2.2) (Peroxisomal long-chain acyl-coA thioesterase Ib) (PTE-Ib) (PTE-2b).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--A--T--L--I--L--E--P--P--G--R--C--C--W--N--E--P--V--R--I--A--V--R--G--L--A--P--E--Q--R--V--T--
ATGTCAGCAACGCTGATCCTGGAGCCCCCAGGCCGCTGCTGCTGGAACGAGCCGGTGCGCATTGCCGTGCGCGGCCTGGCCCCGGAGCAGCGGGTTACGC
::: : ::.::: :::.::::::.::: :.::: :.:::::::::.::::::::::::::::.::.::::::::::::::.::::::::::::::.:::.
ATGGCTGCGACGGTGACCCTGGAACCCGCGGGCAGTTGCTGCTGGGACGAGCCGGTGCGCATCGCTGTGCGCGGCCTGGCTCCGGAGCAGCGGGTCACGT
-M--A--A--T--V--T--L--E--P--A--G--S--C--C--W--D--E--P--V--R--I--A--V--R--G--L--A--P--E--Q--R--V--T--

----------------------------------------------------------------------------------------------------
L--R--A--S--L--R--D--E--K--G--A--L--F--R--A--H--A--R--Y--C--A--D--A--R--G--E--L--D--L--E--R--A--P--A
TGCGCGCGTCCCTGCGCGACGAGAAGGGCGCGCTCTTCCGGGCCCACGCGCGCTACTGCGCCGACGCCCGCGGCGAGCTGGACCTGGAGCGCGCACCCGC
::::: : ::::::::::::::::::::::::::.::: ::::::::::::::::::::::::::::: .:::: :::::::::::: ::::::.:::::
TGCGCTCTTCCCTGCGCGACGAGAAGGGCGCGCTTTTCAGGGCCCACGCGCGCTACTGCGCCGACGCCAACGGCCAGCTGGACCTGGCGCGCGCGCCCGC
L--R--S--S--L--R--D--E--K--G--A--L--F--R--A--H--A--R--Y--C--A--D--A--N--G--Q--L--D--L--A--R--A--P--A

----------------------------------------------------------------------------------------------------
--L--G--G--S--F--A--G--L--E--P--M--G--L--L--W--A--L--E--P--E--K--P--F--W--R--F--L--K--R--D--V--Q--I-
GCTGGGCGGCAGCTTCGCGGGACTCGAGCCCATGGGGCTGCTCTGGGCCCTGGAACCCGAGAAGCCTTTTTGGCGCTTCCTGAAGCGGGACGTACAGATT
:::::::::::::::::.:::.::::::::::::::::: .:::::::.:::::.:::::.:::::::: ::::: ::. :::::::::::::.::::. 
GCTGGGCGGCAGCTTCGTGGGGCTCGAGCCCATGGGGCTCTTCTGGGCTCTGGAGCCCGAAAAGCCTTTATGGCGGTTTGTGAAGCGGGACGTGCAGACG
--L--G--G--S--F--V--G--L--E--P--M--G--L--F--W--A--L--E--P--E--K--P--L--W--R--F--V--K--R--D--V--Q--T-

----------------------------------------------------------------------------------------------------
-P--F--V--V--E--L--E--V--L--D--G--H--D--P--E--P--G--R--L--L--C--Q--A--Q--H--E--R--H--F--L--P--P--G--
CCTTTTGTCGTGGAGTTGGAGGTGCTGGACGGCCACGACCCCGAGCCTGGACGGCTGCTGTGCCAGGCGCAGCACGAGCGCCACTTCCTCCCGCCAGGGG
::.::.:.:::::::.::::::::.: ::::::::::: :::::: : :..::.:: ::: :::.:::   :::::::::: ::::::: ::::: ::::
CCCTTCGCCGTGGAGCTGGAGGTGTTCGACGGCCACGAGCCCGAGGCAGAGCGACTCCTGGGCCGGGCTGTGCACGAGCGCGACTTCCTGCCGCCCGGGG
-P--F--A--V--E--L--E--V--F--D--G--H--E--P--E--A--E--R--L--L--G--R--A--V--H--E--R--D--F--L--P--P--G--

--------------------------------------------------------><------------------------------------------
V--R--R--Q--S--V--R--A--G--R--V--R--A--T--L--F--L--P--P--G--P--G--P--F--P--G--I--I--D--I--F--G--I--G
TGCGGCGCCAGTCGGTGCGAGCGGGCCGGGTGCGCGCCACGCTCTTCCTGCCGCCAGGACCTGGACCCTTCCCAGGGATCATTGACATCTTTGGTATTGG
: :::::: ::.::::::: :::::::::::::::::::::::.:::::::: :::   :.::::::.::::::::::::::::::::::: ::::: ::
TTCGGCGCGAGCCGGTGCGCGCGGGCCGGGTGCGCGCCACGCTTTTCCTGCCTCCA---CTTGGACCTTTCCCAGGGATCATTGACATCTTGGGTATGGG
V--R--R--E--P--V--R--A--G--R--V--R--A--T--L--F--L--P--P-----L--G--P--F--P--G--I--I--D--I--L--G--M--G

----------------------------------------------------------------------------------------------------
--G--G--L--L--E--Y--R--A--S--L--L--A--G--H--G--F--A--T--L--A--L--A--Y--Y--N--F--E--D--L--P--N--N--M-
AGGGGGCCTCTTGGAATATCGAGCCAGCCTCCTTGCTGGCCATGGCTTTGCCACGTTGGCTCTAGCTTATTATAACTTTGAAGATCTCCCCAATAACATG
:::.::::: :::::::::::.:::::.::.:: :::::::::::::::::.:: ::::: ::::::::.:...::::::::::::::::::: ::  : 
AGGAGGCCTGTTGGAATATCGGGCCAGTCTTCTAGCTGGCCATGGCTTTGCTACCTTGGCGCTAGCTTACTGCGACTTTGAAGATCTCCCCAAGAAATTC
--G--G--L--L--E--Y--R--A--S--L--L--A--G--H--G--F--A--T--L--A--L--A--Y--C--D--F--E--D--L--P--K--K--F-

-----------------------------------------------------------><---------------------------------------
-D--N--I--S--L--E--Y--F--E--E--A--V--C--Y--M--L--Q--H--P--Q--V--K--G--P--G--I--G--L--L--G--I--S--L--
GACAACATATCCCTGGAGTACTTCGAAGAAGCCGTATGCTACATGCTTCAACATCCCCAGGTAAAAGGCCCAGGCATTGGGCTTTTGGGCATTTCTCTAG
:::: ::::. .::::: :::::.::::::::: :.:::::::::::::::::. ::::::::::.::::::::::::::::::.:::: ::::::.:::
GACACCATACATCTGGACTACTTTGAAGAAGCCCTGTGCTACATGCTTCAACACACCCAGGTAAAGGGCCCAGGCATTGGGCTTCTGGGAATTTCTTTAG
-D--T--I--H--L--D--Y--F--E--E--A--L--C--Y--M--L--Q--H--T--Q--V--K--G--P--G--I--G--L--L--G--I--S--L--

----------------------------------------------------------------------------------------------------
G--A--D--I--C--L--S--M--A--S--F--L--K--N--V--S--A--T--V--S--I--N--G--S--G--I--S--G--N--T--A--I--N--Y
GAGCTGATATTTGTCTCTCAATGGCCTCATTCTTGAAGAATGTCTCAGCCACAGTTTCCATCAATGGATCTGGGATCAGTGGGAACACAGCCATCAACTA
:.::::::::::::::::: :::::::::::.:::::::::.:::::::::::::::::::::::::::::::. ::::::.::::: : ::::  ::::
GGGCTGATATTTGTCTCTCCATGGCCTCATTTTTGAAGAATATCTCAGCCACAGTTTCCATCAATGGATCTGGATTCAGTGAGAACAAACCCATATACTA
G--A--D--I--C--L--S--M--A--S--F--L--K--N--I--S--A--T--V--S--I--N--G--S--G--F--S--E--N--K--P--I--Y--Y

----------------------------------------------------------------------------------------------------
--K--H--S--S--I--P--P--L--G--Y--D--L--R--R--I--K--V--A--F--S--G--L--V--D--I--V--D--I--R--N--A--L--V-
TAAGCACAGTAGCATTCCACCATTGGGCTATGACCTGAGGAGAATCAAGGTAGCTTTCTCAGGCCTCGTGGACATTGTGGATATAAGGAATGCTCTCGTA
.::: : : ::::::.::::::::::::.:::::::::::::::: ::::::::::::::::::::: :::::::::::::::::::::::: : :.::.
CAAGGAGACTAGCATCCCACCATTGGGCCATGACCTGAGGAGAATGAAGGTAGCTTTCTCAGGCCTCCTGGACATTGTGGATATAAGGAATGATATTGTG
--K--E--T--S--I--P--P--L--G--H--D--L--R--R--M--K--V--A--F--S--G--L--L--D--I--V--D--I--R--N--D--I--V-

----------------------------------------------------------------------------------------------------
-G--G--Y--K--N--P--S--M--I--P--I--E--K--A--Q--G--P--I--L--L--I--V--G--Q--D--D--H--N--W--R--S--E--L--
GGAGGGTACAAGAACCCCAGCATGATTCCAATAGAGAAGGCCCAGGGGCCCATCCTGCTCATTGTTGGTCAGGATGACCATAACTGGAGAAGTGAGTTGT
::.::.::..:::::::: ::::::::::::::::::::::::::::::::::::: .:::::::::::::::::::::::::::::::.::::::::.:
GGGGGATATGAGAACCCCTGCATGATTCCAATAGAGAAGGCCCAGGGGCCCATCCTCTTCATTGTTGGTCAGGATGACCATAACTGGAGGAGTGAGTTAT
-G--G--Y--E--N--P--C--M--I--P--I--E--K--A--Q--G--P--I--L--F--I--V--G--Q--D--D--H--N--W--R--S--E--L--

----------------------------------------------------------------------------------------------------
Y--A--Q--T--V--S--E--R--L--Q--A--H--G--K--E--K--P--Q--I--I--C--Y--P--G--T--G--H--Y--I--E--P--P--Y--F
ATGCCCAAACAGTCTCTGAACGGTTACAGGCCCATGGAAAGGAAAAACCCCAGATCATCTGTTACCCTGGGACTGGGCATTACATCGAGCCTCCTTACTT
:::::::.:.::. :: :::::::::::::::::::::::::.:::: :::::::::::: ::::::::::::::::::::::::.::::::::::::::
ATGCCCAGATAGCGTCAGAACGGTTACAGGCCCATGGAAAGGGAAAAGCCCAGATCATCTCTTACCCTGGGACTGGGCATTACATTGAGCCTCCTTACTT
Y--A--Q--I--A--S--E--R--L--Q--A--H--G--K--G--K--A--Q--I--I--S--Y--P--G--T--G--H--Y--I--E--P--P--Y--F

----------------------------------------------------------------------------------------------------
--P--L--C--P--A--S--L--H--R--L--L--N--K--H--V--I--W--G--G--E--P--R--A--H--S--K--A--Q--E--D--A--W--K-
CCCCCTGTGCCCAGCTTCCCTTCACAGATTACTGAACAAACATGTTATATGGGGTGGGGAGCCCAGGGCTCATTCTAAGGCCCAGGAAGATGCCTGGAAG
:::: :::::::::::::::: :::::::::.::.::::::  :: :: :::::::::::.:::::.:::::.::::::::::::. :::::::::::::
CCCCATGTGCCCAGCTTCCCTGCACAGATTATTGGACAAACCGGTGATCTGGGGTGGGGAACCCAGAGCTCACTCTAAGGCCCAGATAGATGCCTGGAAG
--P--M--C--P--A--S--L--H--R--L--L--D--K--P--V--I--W--G--G--E--P--R--A--H--S--K--A--Q--I--D--A--W--K-

----------------------------------------------------------------->
-Q--I--L--A--F--F--C--K--H--L--G--G--T--Q--K--T--A--V--P--K--L--*-
CAAATTCTAGCCTTCTTCTGCAAACACCTGGGAGGTACCCAGAAAACAGCTGTCCCTAAATTGTAA
:::::::::.::::::::: ::::::::: ::::   :::  :::                     
CAAATTCTAACCTTCTTCTCCAAACACCTTGGAGCGTCCCCCAAA---------------------
-Q--I--L--T--F--F--S--K--H--L--G--A--S--P--K----------------------

Pig Consensus Sequence

>BGISUST0000895976
ATGGCTGCGACGGTGACCCTGGAACCCGCGGGCAGTTGCTGCTGGGACGAGCCGGTGCGCATCGCTGTGCGCGGCCTGGCTCCGGAGCAGCGGGTCACGT
TGCGCTCTTCCCTGCGCGACGAGAAGGGCGCGCTTTTCAGGGCCCACGCGCGCTACTGCGCCGACGCCAACGGCCAGCTGGACCTGGCGCGCGCGCCCGC
GCTGGGCGGCAGCTTCGTGGGGCTCGAGCCCATGGGGCTCTTCTGGGCTCTGGAGCCCGAAAAGCCTTTATGGCGGTTTGTGAAGCGGGACGTGCAGACG
CCCTTCGCCGTGGAGCTGGAGGTGTTCGACGGCCACGAGCCCGAGGCAGAGCGACTCCTGGGCCGGGCTGTGCACGAGCGCGACTTCCTGCCGCCCGGGG
TTCGGCGCGAGCCGGTGCGCGCGGGCCGGGTGCGCGCCACGCTTTTCCTGCCTCCA---CTTGGACCTTTCCCAGGGATCATTGACATCTTGGGTATGGG
AGGAGGCCTGTTGGAATATCGGGCCAGTCTTCTAGCTGGCCATGGCTTTGCTACCTTGGCGCTAGCTTACTGCGACTTTGAAGATCTCCCCAAGAAATTC
GACACCATACATCTGGACTACTTTGAAGAAGCCCTGTGCTACATGCTTCAACACACCCAGGTAAAGGGCCCAGGCATTGGGCTTCTGGGAATTTCTTTAG
GGGCTGATATTTGTCTCTCCATGGCCTCATTTTTGAAGAATATCTCAGCCACAGTTTCCATCAATGGATCTGGATTCAGTGAGAACAAACCCATATACTA
CAAGGAGACTAGCATCCCACCATTGGGCCATGACCTGAGGAGAATGAAGGTAGCTTTCTCAGGCCTCCTGGACATTGTGGATATAAGGAATGATATTGTG
GGGGGATATGAGAACCCCTGCATGATTCCAATAGAGAAGGCCCAGGGGCCCATCCTCTTCATTGTTGGTCAGGATGACCATAACTGGAGGAGTGAGTTAT
ATGCCCAGATAGCGTCAGAACGGTTACAGGCCCATGGAAAGGGAAAAGCCCAGATCATCTCTTACCCTGGGACTGGGCATTACATTGAGCCTCCTTACTT
CCCCATGTGCCCAGCTTCCCTGCACAGATTATTGGACAAACCGGTGATCTGGGGTGGGGAACCCAGAGCTCACTCTAAGGCCCAGATAGATGCCTGGAAG
CAAATTCTAACCTTCTTCTCCAAACACCTTGGAGCGTCCCCCAAA---------------------


>BGISUSP0000895976
MAATVTLEPAGSCCWDEPVRIAVRGLAPEQRVTLRSSLRDEKGALFRAHARYCADANGQLDLARAPALGGSFVGLEPMGLFWALEPEKPLWRFVKRDVQT
PFAVELEVFDGHEPEAERLLGRAVHERDFLPPGVRREPVRAGRVRATLFLPP-LGPFPGIIDILGMGGGLLEYRASLLAGHGFATLALAYCDFEDLPKKF
DTIHLDYFEEALCYMLQHTQVKGPGIGLLGISLGADICLSMASFLKNISATVSINGSGFSENKPIYYKETSIPPLGHDLRRMKVAFSGLLDIVDIRNDIV
GGYENPCMIPIEKAQGPILFIVGQDDHNWRSELYAQIASERLQAHGKGKAQIISYPGTGHYIEPPYFPMCPASLHRLLDKPVIWGGEPRAHSKAQIDAWK
QILTFFSKHLGASPK-------