Sequences
EST Library Info
cbe1Cerebellum
cte1Testicle - RNA from China
gul1Gullet
hyp1Hypothalamus
lnt3Lymphatic nodule tracheobroncalis
lyg1Lymphatic gland
mcp5Mammae, collostrum producing
mgp2Mammary gland - 7 days pre birth
pfco3Unavailable
spl1Spleen
thg3Thyroid gland
tra1Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000180376 (click for geneview)
Transcript ID ENST00000326595(link to ensembl)
Symbol NP_001012524.1
Localtion Chromosome:3:56566287:56630871:1 band: 3p14.3
Description LOC285331
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--H--F--D--S--L--K--S--Y--P--G--S--Q--S--Q--L--F--S--Q--S--T--H--K--Q--P--E--Y--F--C--V--S--P--D--
ATGCACTTTGATTCATTAAAGAGTTATCCTGGTTCTCAATCTCAGCTGTTCTCTCAGTCAACACACAAACAACCTGAGTACTTCTGTGTCTCTCCTGACA
               :::::.::.:::::::.::::::.:::::.:: :.:::::..::::::::::::::::: :::::::::::::::::::: ::::
---------------TTAAAAAGCTATCCTGATTCTCAGTCTCAACTCTCCTCTCGATCAACACACAAACAACCAGAGTACTTCTGTGTCTCTCCGGACA
----------------L--K--S--Y--P--D--S--Q--S--Q--L--S--S--R--S--T--H--K--Q--P--E--Y--F--C--V--S--P--D--

----------------------------------------------------------------------------------------------------
T--Q--E--L--A--D--V--S--S--V--C--T--P--T--T--G--S--Q--V--E--P--S--E--E--E--H--I--A--K--P--I--K--D--V
CTCAGGAGCTGGCTGATGTCAGCAGTGTTTGTACACCTACAACCGGAAGCCAGGTTGAACCTTCAGAGGAGGAGCATATAGCAAAACCTATTAAGGATGT
::::::::.::::::::.:::::::: : :.::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::.:.:..:::::
CTCAGGAGTTGGCTGATATCAGCAGTCTGTATACACCTACAACTGGAAGCCAGGTTGAACCTTCAGAGGAGGAGCATATAGCAAAACCTGTCAGAGATGT
T--Q--E--L--A--D--I--S--S--L--Y--T--P--T--T--G--S--Q--V--E--P--S--E--E--E--H--I--A--K--P--V--R--D--V

--------------------------><------------------------------------------------------------------------
--V--M--A--N--S--K--K--T--N--F--L--R--S--M--T--A--L--L--D--P--A--Q--I--E--E--R--D--R--R--R--Q--K--Q-
GGTTATGGCAAACAGTAAGAAAACAAACTTTCTCCGTTCTATGACTGCTCTCTTGGACCCAGCTCAGATTGAGGAACGAGACAGACGACGACAAAAACAA
::::.::::: ::::: :.:::      :::::::::::::::::::::::.::::::::::::::::::::::::::::::::.::.:::::::::::.
GGTTGTGGCATACAGTCAAAAA------TTTCTCCGTTCTATGACTGCTCTTTTGGACCCAGCTCAGATTGAGGAACGAGACAGGCGGCGACAAAAACAG
--V--V--A--Y--S--Q--K--------F--L--R--S--M--T--A--L--L--D--P--A--Q--I--E--E--R--D--R--R--R--Q--K--Q-

-----------><---------------------------------------------------------------------------------------
-L--E--H--Q--K--A--I--T--A--Q--V--E--E--K--R--R--K--K--Q--L--E--E--E--Q--R--K--K--E--E--Q--E--E--E--
TTAGAGCATCAGAAAGCCATCACTGCCCAGGTAGAAGAGAAGCGCAGGAAGAAACAACTGGAGGAAGAGCAAAGAAAGAAGGAAGAACAAGAAGAGGAGC
:::::.::::::::::::::::.:::.::::::::::::::::::::::::::.::.:: ::.:::::::::::::::::::::::::::::::::::::
TTAGAACATCAGAAAGCCATCATTGCTCAGGTAGAAGAGAAGCGCAGGAAGAAGCAGCTTGAAGAAGAGCAAAGAAAGAAGGAAGAACAAGAAGAGGAGC
-L--E--H--Q--K--A--I--I--A--Q--V--E--E--K--R--R--K--K--Q--L--E--E--E--Q--R--K--K--E--E--Q--E--E--E--

-------------------------------------------------------------------------><-------------------------
L--R--L--A--Q--E--R--E--E--M--Q--K--Q--Y--E--E--D--I--L--K--Q--K--Q--K--E--E--I--M--T--L--K--T--N--E
TTCGCTTAGCACAGGAACGTGAAGAGATGCAGAAACAGTATGAAGAAGACATACTTAAGCAAAAACAAAAGGAAGAAATCATGACTCTCAAGACAAATGA
 :::::::::::.:::::: :::::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::::::::.:::::::::::
GTCGCTTAGCACGGGAACGAGAAGAGATGCAAAAACAGTATGAAGAAGATATACTTAAGCAAAAACAAAAGGAAGAAATCATGACTCTTAAGACAAATGA
R--R--L--A--R--E--R--E--E--M--Q--K--Q--Y--E--E--D--I--L--K--Q--K--Q--K--E--E--I--M--T--L--K--T--N--E

----------------------------------------------------------------------------------------------------
--L--F--Q--T--M--Q--R--A--Q--E--L--A--Q--R--L--K--Q--E--Q--R--I--R--E--L--A--Q--K--G--H--D--T--S--R-
GCTATTCCAGACAATGCAGCGAGCACAGGAACTGGCACAGAGACTAAAACAAGAACAAAGAATCCGAGAATTGGCGCAAAAGGGACATGACACTTCTAGA
:::.::::::::.:::::: ::::.::.::.::::::::::::::.:::::::::::.::::::::::::::::: ::::::::::::::::::::.:::
GCTGTTCCAGACGATGCAGAGAGCGCAAGAGCTGGCACAGAGACTGAAACAAGAACAGAGAATCCGAGAATTGGCTCAAAAGGGACATGACACTTCCAGA
--L--F--Q--T--M--Q--R--A--Q--E--L--A--Q--R--L--K--Q--E--Q--R--I--R--E--L--A--Q--K--G--H--D--T--S--R-

------------------><--------------------------------------------------------------------------------
-L--I--K--N--L--G--V--D--T--I--Q--M--E--Y--N--A--S--------N--I--S--N--S--R--H--D--S--D--E--I--S--G--
CTGATTAAAAATCTTGGTGTTGATACAATACAAATGGAATATAATGCATCT------AACATTTCAAATTCAAGACATGATTCTGATGAAATCAGTGGTA
.:::::::::::::::::   ::::::.:::::.::::::::::::.::::      ::::::.:::::::::::::: ..:. :::::: :::::::::
TTGATTAAAAATCTTGGT---GATACAGTACAAGTGGAATATAATGTATCTACTAACAACATTCCAAATTCAAGACATTGCTTGGATGAATTCAGTGGTA
-L--I--K--N--L--G-----D--T--V--Q--V--E--Y--N--V--S--T--N--N--I--P--N--S--R--H--C--L--D--E--F--S--G--

-----------------------------------------------------------><---------------------------------------
K--M--N--T--Y--M--N--S--T--T-----S--K--K--D--T--G--V--Q--T--D--D--L--N--I--G--I--F--T--N--A--E--S--H
AAATGAATACATATATGAATTCTACGACT---TCTAAGAAGGATACTGGTGTGCAAACAGATGACTTAAATATAGGAATATTCACCAATGCAGAATCACA
:::::::::::::::: ::.::::...:.   .:.::::::::::::::::::::::::                                         
AAATGAATACATATATCAACTCTATAGCCTTTCCCAAGAAGGATACTGGTGTGCAAACA-----------------------------------------
K--M--N--T--Y--I--N--S--I--A--F--P--K--K--D--T--G--V--Q--T------------------------------------------

----------------------------------------------------------------------------------------------------
--C--G--S--L--M--E--R--D--I--T--N--C--S--S--P--E--I--S--A--E--L--I--G--Q--F--S--T--K--K--N--K--Q--E-
TTGTGGATCATTAATGGAGAGGGACATCACAAATTGTTCATCTCCTGAGATTTCGGCAGAACTTATTGGACAGTTTAGCACCAAGAAAAACAAGCAAGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--T--Q--D--K--G--A--S--L--E--K--E--N--N--R--C--N--D--Q--C--N--Q--F--T--R--I--E--K--Q--T--K--H--M--
CTAACTCAGGATAAAGGAGCCAGCTTAGAAAAAGAAAACAATCGGTGTAATGACCAGTGTAATCAGTTCACAAGAATAGAGAAACAAACAAAACACATGA
                                                   ::.::.::::: :::::::::::.:.:::::::::::::::.::.::::
---------------------------------------------------GATCAATGTAA-CAGTTCACAAGGACAGAGAAACAAACAAAGCATATGA
----------------------------------------------------D--Q--C--N--Q--F--T--R--T--E--K--Q--T--K--H--M--

----------------------------------------------------------------------------------------------------
K--K--Y--P--K--R--P--D--W--N--I--N--K--P--P--K--R--Y--I--P--A--S--E--K--Y--P--K--Q--L--Q--K--Q--R--E
AGAAATATCCTAAAAGGCCTGATTGGAATATAAATAAGCCACCTAAAAGGTATATTCCAGCATCAGAAAAGTACCCTAAACAGCTTCAAAAGCAGAGAGA
::::::::::::::::::::::::::::::::::::::::::..:.:::::::::::::::::::::::::::::::::::::::::::::.: ::::::
AGAAATATCCTAAAAGGCCTGATTGGAATATAAATAAGCCACTCAGAAGGTATATTCCAGCATCAGAAAAGTACCCTAAACAGCTTCAAAAACTGAGAGA
K--K--Y--P--K--R--P--D--W--N--I--N--K--P--L--R--R--Y--I--P--A--S--E--K--Y--P--K--Q--L--Q--K--L--R--E

----------------------------------------------------------------------------------------------------
--E--K--K--V--R--R--Q--M--E--L--L--H--L--V--E--K--N--N--P--G--H--L--S--Q--N--R--G--I--S--P--E--I--F-
AGAAAAAAAAGTAAGGAGGCAGATGGAATTGCTTCATTTGGTAGAAAAAAATAATCCTGGGCACCTCTCTCAAAACAGAGGCATTTCACCAGAAATTTTT
:::::::::::::::.::::::::::::.::::::::::::::::::.::::::::::::.::. :::::: .::.:::::::.::::::::::.::.::
AGAAAAAAAAGTAAGAAGGCAGATGGAACTGCTTCATTTGGTAGAAAGAAATAATCCTGGACATATCTCTCCGAATAGAGGCACTTCACCAGAAGTTCTT
--E--K--K--V--R--R--Q--M--E--L--L--H--L--V--E--R--N--N--P--G--H--I--S--P--N--R--G--T--S--P--E--V--L-

--------------------------------------------------------------><------------------------------------
-H--S--S--H--Q--E--T--E--S--K--L--R--W--H--L--V--K--K--V--K--S--I--L--D--D--V--L--T--F--L--D--S--K--
CATTCATCTCATCAAGAAACGGAGTCAAAGTTGAGGTGGCATCTAGTCAAAAAGGTAAAGTCCATCTTAGATGATGTGTTGACGTTTCTGGATTCAAAAC
:::::: ::::::::::::: :::.:::.::: :.:::::: ::  :::::::::::                                           
CATTCAGCTCATCAAGAAACTGAGCCAAGGTTTAAGTGGCAGCTCCTCAAAAAGGTA-------------------------------------------
-H--S--A--H--Q--E--T--E--P--R--F--K--W--Q--L--L--K--K--V--------------------------------------------

--------------------------><------------------------------------------------------------------------
H--S--F--S--Y--V--C--F--V--P--V--V--K--N--R--T--Q--Q--T--Q--N--T--L--H--L--P--L--K--N--S--S--Y--E--R
ACAGTTTCTCATACGTATGCTTTGTTCCAGTAGTGAAAAACAGAACCCAACAAACTCAAAATACATTACATTTACCACTAAAAAACAGTAGCTATGAGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--N--L--I--S--G--S--N--Q--T--E--L--S--S--G--I--S--E--S--S--H--F--I--P--Y--V--R--T--N--E--I--Y--Y-
AGAGAATTTGATCTCAGGAAGTAATCAAACAGAATTATCATCTGGGATTTCTGAATCATCCCATTTTATTCCGTATGTTCGAACAAATGAGATCTATTAC
              :::::..:..:::.::::: :.::::.::::::::::::::.::..:.:::::::::: ::::: ::::: ::::::::.::::::
-------------GCAGGAGATGGTCAGACAGACTCATCACCTGGGATTTCTGAACCACTCTATTTTATTCCCTATGTGCGAACCAATGAGATTTATTAC
--------------A--G--D--G--Q--T--D--S--S--P--G--I--S--E--P--L--Y--F--I--P--Y--V--R--T--N--E--I--Y--Y-

------------------------------------------------------------------><--------------------------------
-L--D--P--D--A--P--L--S--G--P--S--T--Q--D--P--Q--Y--Q--N--S--Q--D--C--G--Q--K--R--Q--L--F--D--S--D--
CTTGATCCCGATGCACCATTGTCTGGGCCTTCAACCCAGGACCCTCAGTACCAAAATTCACAAGACTGTGGCCAAAAACGACAGCTATTTGATTCTGACT
:::::::: :::::::::::::::.::::::.:::::::::.:::::::::               ::::.::::.:::.::::::.::::: .      
CTTGATCCAGATGCACCATTGTCTAGGCCTTTAACCCAGGATCCTCAGTAC---------------TGTGACCAAGAACAACAGCTGTTTGAGCAA----
-L--D--P--D--A--P--L--S--R--P--L--T--Q--D--P--Q--Y-----------------C--D--Q--E--Q--Q--L--F--E--Q-----

-------------------------------------------------------------------------------------------><-------
C--V--R--D--P--L--L--N--P--N--M--V--K--N--R--D--R--Q--Q--A--I--L--K--G--L--S--E--L--R--Q--G--L--L--Q
GTGTCAGGGATCCACTTCTTAATCCTAACATGGTGAAAAATAGGGATCGACAGCAAGCAATCCTTAAGGGACTTTCAGAACTGAGACAGGGCCTTCTCCA
   :::::::.:::::::::::.::.::: ::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
--CTCAGGGACCCACTTCTTAACCCCAACTTGGTGAAAAACAGGGATCGACAGCAAGCAATCCTTAAGGGACTTTCAGAACTGAGACAGGGCCTTCTCCA
---L--R--D--P--L--L--N--P--N--L--V--K--N--R--D--R--Q--Q--A--I--L--K--G--L--S--E--L--R--Q--G--L--L--Q

----------------------------------------------------------------------------
--K--Q--K--E--L--E--S--S--L--L--P--L--A--E--N--Q--E--E--S--F--G--S--S--F--*-
GAAGCAAAAGGAGTTGGAAAGTAGTCTCCTGCCTTTAGCTGAAAATCAAGAAGAGAGTTTTGGTTCTTCATTTTAA
::::::::.:::.::::::: ::.:::: :::::::::::: ::::::::::::::.::::.::::::..::::::
GAAGCAAAGGGAATTGGAAACTAATCTCATGCCTTTAGCTGCAAATCAAGAAGAGAATTTTAGTTCTTTGTTTTAA
--K--Q--R--E--L--E--T--N--L--M--P--L--A--A--N--Q--E--E--N--F--S--S--L--F--*-

Pig Consensus Sequence

>BGISUST0000876412
---------------TTAAAAAGCTATCCTGATTCTCAGTCTCAACTCTCCTCTCGATCAACACACAAACAACCAGAGTACTTCTGTGTCTCTCCGGACA
CTCAGGAGTTGGCTGATATCAGCAGTCTGTATACACCTACAACTGGAAGCCAGGTTGAACCTTCAGAGGAGGAGCATATAGCAAAACCTGTCAGAGATGT
GGTTGTGGCATACAGTCAAAAA------TTTCTCCGTTCTATGACTGCTCTTTTGGACCCAGCTCAGATTGAGGAACGAGACAGGCGGCGACAAAAACAG
TTAGAACATCAGAAAGCCATCATTGCTCAGGTAGAAGAGAAGCGCAGGAAGAAGCAGCTTGAAGAAGAGCAAAGAAAGAAGGAAGAACAAGAAGAGGAGC
GTCGCTTAGCACGGGAACGAGAAGAGATGCAAAAACAGTATGAAGAAGATATACTTAAGCAAAAACAAAAGGAAGAAATCATGACTCTTAAGACAAATGA
GCTGTTCCAGACGATGCAGAGAGCGCAAGAGCTGGCACAGAGACTGAAACAAGAACAGAGAATCCGAGAATTGGCTCAAAAGGGACATGACACTTCCAGA
TTGATTAAAAATCTTGGT---GATACAGTACAAGTGGAATATAATGTATCTACTAACAACATTCCAAATTCAAGACATTGCTTGGATGAATTCAGTGGTA
AAATGAATACATATATCAACTCTATAGCCTTTCCCAAGAAGGATACTGGT--------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------GATCAATGtcAGTTCACAAGGACAGAGAAACAAACAAAGCATATGAAGAAATATCCTA
AAAGGCCTGATTGGAATATAAATAAGCCACTCAGAAGGTATATTCCAGCATCAGAAAAGTACCCTAAACAGCTTCAAAAACTGAGAGAAGAAAAAAAAGT
AAGAAGGCAGATGGAACTGCTTCATTTGGTAGAAAGAAATAATCCTGGACATATCTCTCCGAATAGAGGCACTTCACCAGAAGTTCTTCATTCAGCTCAT
CAAGAAACTGAGCCAAGGTTTAAGTGGCAGCTCCTCAAAAAGGTA-------------------------------------------------------
----------------------------------------------------------------------------------------------------
-GCAGGAGATGGTCAGACAGACTCATCACCTGGGATTTCTGAACCACTCTATTTTATTCCCTATGTGCGAACCAATGAGATTTATTACCTTGATCCAGAT
GCACCATTGTCTAGGCCTTTAACCCAGGATCCTCAGTAC---------------TGTGACCAAGAACAACAGCTGTTTGAGCAACTCAGGGACCCACTTC
TTAACCCCAACTTGGTGAAAAACAGGGATCGACAGCAAGCAATCCTTAAGGGACTTTCAGAACTGAGACAGGGCCTTCTCCAGAAGCAAAGGGAATTGGA
AACTAATCTCATGCCTTTAGCTGCAAATCAAGAAGAGAATTTTAGTTCTTTGTTTTAA


>BGISUSP0000876412
-----LKSYPDSQSQLSSRSTHKQPEYFCVSPDTQELADISSLYTPTTGSQVEPSEEEHIAKPVRDVVVAYSQK--FLRSMTALLDPAQIEERDRRRQKQ
LEHQKAIIAQVEEKRRKKQLEEEQRKKEEQEEERRLAREREEMQKQYEEDILKQKQKEEIMTLKTNELFQTMQRAQELAQRLKQEQRIRELAQKGHDTSR
LIKNLG-DTVQVEYNVSTNNIPNSRHCLDEFSGKMNTYINSIAFPKKDTG--------------------------------------------------
--------------DQCQFTRTEKQTKHMKKYPKRPDWNINKPLRRYIPASEKYPKQLQKLREEKKVRRQMELLHLVERNNPGHISPNRGTSPEVLHSAH
QETEPRFKWQLLKKV----------------------------------------------------AGDGQTDSSPGISEPLYFIPYVRTNEIYYLDPD
APLSRPLTQDPQY-----CDQEQQLFEQLRDPLLNPNLVKNRDRQQAILKGLSELRQGLLQKQRELETNLMPLAANQEENFSSLF*