Sequences
EST Library Info
nmm1Newborn 115 days, mucosal membranes
Clusters
Oligos
SNPs

Gene ID ENSG00000137313 (click for geneview)
Transcript ID ENST00000327357(link to ensembl)
Symbol TRIM26
Localtion Chromosome:6:30260213:30289104:-1 band: 6p21.33
Description Tripartite motif protein 26 (Zinc finger protein 173) (Acid finger protein) (AFP) (RING finger protein 95). [Source:Uniprot/SWISSPROT;Acc:Q12899]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--T--S--A--P--L--R--S--L--E--E--E--V--T--C--S--I--C--L--D--Y--L--R--D--P--V--T--I--D--C--G--H--
ATGGCCACGTCAGCCCCACTACGGAGCCTGGAAGAGGAGGTGACCTGCTCCATCTGTCTTGATTACCTGCGGGACCCTGTGACCATTGACTGTGGCCACG
:::::::::::::: :::::.:::::::::::::::::::::::::::::::::::.:::::::::::::::::::: ::::::::::::::.::.::::
ATGGCCACGTCAGCGCCACTGCGGAGCCTGGAAGAGGAGGTGACCTGCTCCATCTGCCTTGATTACCTGCGGGACCCAGTGACCATTGACTGCGGTCACG
-M--A--T--S--A--P--L--R--S--L--E--E--E--V--T--C--S--I--C--L--D--Y--L--R--D--P--V--T--I--D--C--G--H--

----------------------------------------------------------------------------------------------------
V--F--C--R--S--C--T--T--D--V--R--P--I--S--G--S--R--P--V--C--P--L--C--K--K--P--F--K--K--E--N--I--R--P
TCTTCTGCCGCAGCTGCACCACAGACGTCCGCCCCATCTCAGGGAGCCGCCCCGTCTGCCCACTCTGCAAGAAGCCTTTTAAGAAGGAGAACATCCGACC
::::::::::::::::.::::: :::.:::.:::..::::.:::.:::::::::::::::: :: ::::::::.::::: : .::::::::.::: :.::
TCTTCTGCCGCAGCTGTACCACCGACATCCACCCTGTCTCGGGGGGCCGCCCCGTCTGCCCCCTGTGCAAGAAACCTTTAACAAAGGAGAATATCAGGCC
V--F--C--R--S--C--T--T--D--I--H--P--V--S--G--G--R--P--V--C--P--L--C--K--K--P--L--T--K--E--N--I--R--P

----------------------------------------------------------------------------------------------------
--V--W--Q--L--A--S--L--V--E--N--I--E--R--L--K--V--D--K--G--R--Q--P--G--E--V--T--R--E--Q--Q--D--A--K-
CGTGTGGCAACTGGCCAGCCTGGTGGAGAACATTGAGCGGCTGAAGGTGGACAAGGGCAGGCAGCCGGGAGAGGTGACCCGGGAGCAGCAGGATGCAAAG
.::::::::.:::::::::::::::::::::::.::::::::::::::::::: :::: ::::::::::.::::::.::::::::::::::::..:::.:
TGTGTGGCAGCTGGCCAGCCTGGTGGAGAACATCGAGCGGCTGAAGGTGGACACGGGCCGGCAGCCGGGGGAGGTGGCCCGGGAGCAGCAGGACACAAGG
--V--W--Q--L--A--S--L--V--E--N--I--E--R--L--K--V--D--T--G--R--Q--P--G--E--V--A--R--E--Q--Q--D--T--R-

----------------------------------------------------------------------------------------------------
-L--C--E--R--H--R--E--K--L--H--Y--Y--C--E--D--D--G--K--L--L--C--V--M--C--R--E--S--R--E--H--R--P--H--
TTGTGCGAGCGACACCGAGAGAAGCTGCACTACTACTGTGAGGACGACGGGAAGCTGCTGTGCGTGATGTGCCGGGAGTCCCGGGAGCACAGGCCCCACA
.:::::::::::::::..:::::.::::::::::::::.::::::::.:: :::::::::::::: :::::::: :::::::::::::::::::::::::
CTGTGCGAGCGACACCAGGAGAAACTGCACTACTACTGCGAGGACGATGGCAAGCTGCTGTGCGTCATGTGCCGCGAGTCCCGGGAGCACAGGCCCCACA
-L--C--E--R--H--Q--E--K--L--H--Y--Y--C--E--D--D--G--K--L--L--C--V--M--C--R--E--S--R--E--H--R--P--H--

-------------------------------------><-------------------------------------------------------------
T--A--V--L--M--E--K--A--A--Q--P--H--R--E--K--I--L--N--H--L--S--T--L--R--R--D--R--D--K--I--Q--G--F--Q
CGGCCGTCCTCATGGAGAAGGCCGCCCAGCCCCACAGGGAAAAAATCCTGAACCACCTGAGTACCCTAAGGAGGGACAGAGACAAAATTCAGGGCTTCCA
:::::::::: .::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::.:::::::::::::::::::::::.::
CGGCCGTCCTGGTGGAGAAGGCCGCCCAGCCCCACAGGGAGAAAATCCTGAACCACCTGAGTACCCTAAGGAGAGACAGAGACAAAATTCAGGGCTTTCA
T--A--V--L--V--E--K--A--A--Q--P--H--R--E--K--I--L--N--H--L--S--T--L--R--R--D--R--D--K--I--Q--G--F--Q

---------------------------------><-----------------------------------------------------------------
--A--K--G--E--A--D--I--L--A--A--L--K--K--L--Q--D--Q--R--Q--Y--I--V--A--E--F--E--Q--G--H--Q--F--L--R-
GGCAAAGGGAGAAGCTGATATCCTGGCCGCGCTGAAGAAGCTCCAGGACCAGAGGCAGTACATTGTGGCTGAGTTTGAGCAGGGTCATCAGTTCCTGAGG
::: :::::::::::::::::::::::.: ::::::::::::::::::::::::::::..:::. :::::: .:::::.:::::.::.::::::::: ::
GGCCAAGGGAGAAGCTGATATCCTGGCTGAGCTGAAGAAGCTCCAGGACCAGAGGCAGCGCATCCTGGCTGCATTTGAACAGGGCCACCAGTTCCTGTGG
--A--K--G--E--A--D--I--L--A--E--L--K--K--L--Q--D--Q--R--Q--R--I--L--A--A--F--E--Q--G--H--Q--F--L--W-

----------------------------------------------------------------------------------------------------
-E--R--E--E--H--L--L--E--Q--L--A--K--L--E--Q--E--L--T--E--G--R--E--K--F--K--S--R--G--V--G--E--L--A--
GAGCGGGAGGAACACCTGCTGGAACAGCTGGCGAAGCTGGAGCAGGAGCTCACGGAGGGCAGGGAGAAGTTCAAGAGCCGGGGCGTCGGGGAGCTTGCCC
::::::::: :.::::::::::: :::::::::::::::::::::::: ::::.:::::::::::::::: ::::: : :::::: ::::::::::::::
GAGCGGGAGCAGCACCTGCTGGACCAGCTGGCGAAGCTGGAGCAGGAGGTCACAGAGGGCAGGGAGAAGTACAAGACCAGGGGCGACGGGGAGCTTGCCC
-E--R--E--Q--H--L--L--D--Q--L--A--K--L--E--Q--E--V--T--E--G--R--E--K--Y--K--T--R--G--D--G--E--L--A--

----------------------------------------------------------------><---------------------><-----------
R--L--A--L--V--I--S--E--L--E--G--K--A--Q--Q--P--A--A--E--L--M--Q--D--T--R--D--F--L--N--R--Y--P--R--K
GGCTGGCCCTGGTCATCTCCGAACTGGAGGGCAAGGCGCAGCAGCCAGCTGCAGAGCTCATGCAGGACACGAGAGACTTCCTAAACAGGTATCCACGGAA
::::::: : :::::::::.::.:::::::::::::::::::::::.                                          :::::::::::
GGCTGGCGCAGGTCATCTCTGAGCTGGAGGGCAAGGCGCAGCAGCCG------------------------------------------TATCCACGGAA
R--L--A--Q--V--I--S--E--L--E--G--K--A--Q--Q--P--------------------------------------------Y--P--R--K

----------------------------------------------------------------------------------------------------
--K--F--W--V--G--K--P--I--A--R--V--V--K--K--K--T--G--E--F--S--D--K--L--L--S--L--Q--R--G--L--R--E--F-
GAAGTTCTGGGTTGGGAAACCCATTGCTCGAGTGGTTAAAAAAAAGACCGGAGAATTCTCAGATAAACTCCTCTCTCTGCAACGAGGCCTGAGGGAATTC
::::::::::.:::::::::::::::::::..::::::::::.:.::: ::::::::::::::::::::::: ::::::::.::::::::: :.::::::
GAAGTTCTGGATTGGGAAACCCATTGCTCGGATGGTTAAAAAGAGGACAGGAGAATTCTCAGATAAACTCCTGTCTCTGCAGCGAGGCCTGCGAGAATTC
--K--F--W--I--G--K--P--I--A--R--M--V--K--K--R--T--G--E--F--S--D--K--L--L--S--L--Q--R--G--L--R--E--F-

---><-------------------------------><--------------------------------------------------------------
-Q--G--K--L--L--R--D--L--E--Y--K--T--V--S--V--T--L--D--P--Q--S--A--S--G--Y--L--Q--L--S--E--D--W--K--
CAGGGGAAGCTGCTGAGAGACTTGGAATATAAGACAGTGAGCGTCACCCTGGACCCACAGTCGGCCAGTGGGTACCTGCAGCTGTCAGAGGACTGGAAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
C--V--T--Y--T--S--L--Y--K--S--A--Y--L--H--P--Q--Q--F--D--C--E--P--G--V--L--G--S--K--G--F--T--W--G--K
GCGTGACCTACACCAGCCTGTACAAGAGTGCCTACCTGCACCCCCAGCAGTTTGACTGTGAGCCTGGGGTGCTAGGCAGCAAGGGCTTCACCTGGGGCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--Y--W--E--V--E--V--E--R--E--G--W--S--E--D--E--E--E--G--D--E--E--E--E--G--E--E--E--E--E--E--E--E-
GGTCTACTGGGAAGTGGAAGTGGAGAGGGAGGGCTGGTCTGAGGATGAAGAAGAGGGGGATGAGGAGGAAGAGGGAGAAGAGGAGGAGGAGGAAGAGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--G--Y--G--D--G--Y--D--D--W--E--T--D--E--D--E--E--S--L--G--D--E--E--E--E--E--E--E--E--E--E--E--V--
GCCGGCTATGGGGATGGATATGACGACTGGGAAACGGACGAAGATGAGGAATCGTTGGGCGATGAAGAGGAAGAAGAGGAGGAGGAAGAGGAGGAAGTTC
                                                                                          ::::::::::
------------------------------------------------------------------------------------------GAGGAAGTTC
-------------------------------------------------------------------------------------------E--E--V--

----------------------------------------------------------------------------------------------------
L--E--S--C--M--V--G--V--A--R--D--S--V--K--R--K--G--D--L--S--L--R--P--E--D--G--V--W--A--L--R--L--S--S
TGGAAAGCTGCATGGTGGGGGTGGCTAGAGACTCTGTGAAGAGGAAGGGAGACCTCTCCCTGCGGCCAGAGGATGGCGTGTGGGCGCTGCGCCTCTCCTC
:::::::::::::::::::::::::.:::::::: ::::::::::.:::.:::::::::::::::::.::::::::::::::::::::::::::::::::
TGGAAAGCTGCATGGTGGGGGTGGCCAGAGACTCGGTGAAGAGGAGGGGGGACCTCTCCCTGCGGCCGGAGGATGGCGTGTGGGCGCTGCGCCTCTCCTC
L--E--S--C--M--V--G--V--A--R--D--S--V--K--R--R--G--D--L--S--L--R--P--E--D--G--V--W--A--L--R--L--S--S

----------------------------------------------------------------------------------------------------
--S--G--I--W--A--N--T--S--P--E--A--E--L--F--P--A--L--R--P--R--R--V--G--I--A--L--D--Y--E--G--G--T--V-
CTCCGGCATCTGGGCCAACACCAGCCCCGAGGCTGAGCTTTTCCCAGCACTGCGGCCCCGGAGAGTGGGCATCGCCCTGGATTATGAAGGGGGCACCGTG
:::.:::::::::::::::::::: ::::::::.:::::.:::::.:::: ::::::::::::.::::::::::::::::::::.:::::::::::::::
CTCTGGCATCTGGGCCAACACCAGACCCGAGGCCGAGCTCTTCCCGGCACAGCGGCCCCGGAGGGTGGGCATCGCCCTGGATTACGAAGGGGGCACCGTG
--S--G--I--W--A--N--T--R--P--E--A--E--L--F--P--A--Q--R--P--R--R--V--G--I--A--L--D--Y--E--G--G--T--V-

----------------------------------------------------------------------------------------------------
-T--F--T--N--A--E--S--Q--E--L--I--Y--T--F--T--A--T--F--T--R--R--L--V--P--F--L--W--L--K--W--P--G--T--
ACTTTCACCAACGCAGAGTCACAGGAACTCATCTACACCTTCACTGCCACCTTCACCCGGCGCCTGGTCCCCTTCCTGTGGCTCAAGTGGCCAGGAACAC
::::::::::::::::::::.::.:::::::::::.:::::::  :::::::::::::::::.::: ::::::::::::::::::.::::::.:::::::
ACTTTCACCAACGCAGAGTCGCAAGAACTCATCTATACCTTCAAGGCCACCTTCACCCGGCGTCTGCTCCCCTTCCTGTGGCTCAGGTGGCCGGGAACAC
-T--F--T--N--A--E--S--Q--E--L--I--Y--T--F--K--A--T--F--T--R--R--L--L--P--F--L--W--L--R--W--P--G--T--

------------------->
R--L--L--L--R--P--*-
GCCTCCTGCTAAGACCCTGA
::::::::::.:::::::::
GCCTCCTGCTGAGACCCTGA
R--L--L--L--R--P--*-

Pig Consensus Sequence

>BGISUST0000884951
ATGGCCACGTCAGCGCCACTGCGGAGCCTGGAAGAGGAGGTGACCTGCTCCATCTGCCTTGATTACCTGCGGGACCCAGTGACCATTGACTGCGGTCACG
TCTTCTGCCGCAGCTGTACCACCGACATCCACCCTGTCTCGGGGGGCCGCCCCGTCTGCCCCCTGTGCAAGAAACCTTTAACAAAGGAGAATATCAGGCC
TGTGTGGCAGCTGGCCAGCCTGGTGGAGAACATCGAGCGGCTGAAGGTGGACACGGGCCGGCAGCCGGGGGAGGTGGCCCGGGAGCAGCAGGACACAAGG
CTGTGCGAGCGACACCAGGAGAAACTGCACTACTACTGCGAGGACGATGGCAAGCTGCTGTGCGTCATGTGCCGCGAGTCCCGGGAGCACAGGCCCCACA
CGGCCGTCCTGGTGGAGAAGGCCGCCCAGCCCCACAGGGAGAAAATCCTGAACCACCTGAGTACCCTAAGGAGAGACAGAGACAAAATTCAGGGCTTTCA
GGCCAAGGGAGAAGCTGATATCCTGGCTGAGCTGAAGAAGCTCCAGGACCAGAGGCAGCGCATCCTGGCTGCATTTGAACAGGGCCACCAGTTCCTGTGG
GAGCGGGAGCAGCACCTGCTGGACCAGCTGGCGAAGCTGGAGCAGGAGGTCACAGAGGGCAGGGAGAAGTACAAGACCAGGGGCGACGGGGAGCTTGCCC
GGCTGGCGCAGGTCATCTCTGAGCTGGAGGGCAAGGCGCAGCAGCCG------------------------------------------TATCCACGGAA
GAAGTTCTGGATTGGGAAACCCATTGCTCGGATGGTTAAAAAGAGGACAGGAGAATTCTCAGATAAACTCCTGTCTCTGCAGCGAGGCCTGCGAGAATTC
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------GAGGAAGTTC
TGGAAAGCTGCATGGTGGGGGTGGCCAGAGACTCGGTGAAGAGGAGGGGGGACCTCTCCCTGCGGCCGGAGGATGGCGTGTGGGCGCTGCGCCTCTCCTC
CTCTGGCATCTGGGCCAACACCAGACCCGAGGCCGAGCTCTTCCCGGCACAGCGGCCCCGGAGGGTGGGCATCGCCCTGGATTACGAAGGGGGCACCGTG
ACTTTCACCAACGCAGAGTCGCAAGAACTCATCTATACCTTCAAGGCCACCTTCACCCGGCGTCTGCTCCCCTTCCTGTGGCTCAGGTGGCCGGGAACAC
GCCTCCTGCTGAGACCCTGA


>BGISUSP0000884951
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDIHPVSGGRPVCPLCKKPLTKENIRPVWQLASLVENIERLKVDTGRQPGEVAREQQDTR
LCERHQEKLHYYCEDDGKLLCVMCRESREHRPHTAVLVEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAELKKLQDQRQRILAAFEQGHQFLW
EREQHLLDQLAKLEQEVTEGREKYKTRGDGELARLAQVISELEGKAQQP--------------YPRKKFWIGKPIARMVKKRTGEFSDKLLSLQRGLREF
----------------------------------------------------------------------------------------------------
------------------------------EEVLESCMVGVARDSVKRRGDLSLRPEDGVWALRLSSSGIWANTRPEAELFPAQRPRRVGIALDYEGGTV
TFTNAESQELIYTFKATFTRRLLPFLWLRWPGTRLLLRP*