Sequences
EST Library Info
eje1Foetus 50 days, jejunum
fat1Fatt
hea1Heart
jca1Joint capsule
Clusters
Oligos
SNPs

Gene ID ENSG00000165810 (click for geneview)
Transcript ID ENST00000327705(link to ensembl)
Symbol BTNL9
Localtion Chromosome:5:180399854:180421121:1 band: 5q35.3
Description Butyrophilin-like protein 9 precursor (UNQ1900/PRO4346).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--V--D--L--S--V--S--P--D--S--L--K--P--V--S--L--T--S--S--L--V--F--L--M--H--L--L--L--L--Q--P--G--E--
ATGGTGGACCTCTCAGTCTCCCCAGACTCCTTGAAGCCAGTATCGCTGACCAGCAGTCTTGTCTTCCTCATGCACCTCCTCCTCCTTCAGCCTGGGGAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------><------------------------------------------------------------------------------------------
P--S--S--E--V--K--V--L--G--P--E--Y--P--I--L--A--L--V--G--E--E--V--E--F--P--C--H--L--W--P--Q--L--D--A
CGAGCTCAGAGGTCAAGGTGCTAGGCCCTGAGTATCCCATCCTGGCCCTCGTCGGGGAGGAGGTGGAGTTCCCGTGCCACCTATGGCCACAGCTGGATGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--Q--M--E--I--R--W--F--R--S--Q--T--F--N--V--V--H--L--Y--Q--E--Q--Q--E--L--P--G--R--Q--M--P--A--F-
CCAGCAAATGGAGATCCGCTGGTTCCGGAGTCAGACCTTCAATGTGGTACACCTGTACCAGGAGCAGCAGGAGCTCCCTGGCAGGCAGATGCCGGCGTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-R--N--R--T--K--L--V--K--D--D--I--A--Y--G--S--V--V--L--Q--L--H--S--I--I--P--S--D--K--G--T--Y--G--C--
CGGAACAGGACCAAGTTGGTCAAGGACGACATCGCCTATGGCAGCGTGGTCCTGCAGCTTCACAGCATCATCCCCTCTGACAAGGGCACATATGGCTGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------><---------------------------------------------
R--F--H--S--D--N--F--S--G--E--A--L--W--E--L--E--V--A--G--L--G--S--D--P--H--L--S--L--E--G--F--K--E--G
GCTTCCACTCCGACAACTTCTCTGGCGAAGCTCTCTGGGAACTGGAGGTAGCAGGGCTGGGCTCAGACCCTCACCTCTCCCTTGAGGGCTTCAAGGAAGG
                                                        :::::::::::::::::: :::::::::::::::::::.::.::
--------------------------------------------------------CTGGGCTCAGACCCTCACATCTCCCTTGAGGGCTTCAAAGAGGG
---------------------------------------------------------L--G--S--D--P--H--I--S--L--E--G--F--K--E--G

----------------------------------------------------------------------------------------------------
--G--I--Q--L--R--L--R--S--S--G--W--Y--P--K--P--K--V--Q--W--R--D--H--Q--G--Q--C--L--P--P--E--F--E--A-
AGGCATTCAGCTGAGGCTCAGATCCAGTGGCTGGTACCCCAAGCCTAAGGTTCAGTGGAGAGACCACCAGGGACAGTGCCTGCCTCCAGAGTTTGAAGCC
::::::::::::.:::. ::: ::::::::::::::::::: :::   ::.:::::::::::::::.:: ::::..:::.::::::::::: .::::: :
AGGCATTCAGCTAAGGTGCAGCTCCAGTGGCTGGTACCCCATGCCGCTGGCTCAGTGGAGAGACCATCATGGACGATGCTTGCCTCCAGAGACTGAAGAC
--G--I--Q--L--R--C--S--S--S--G--W--Y--P--M--P--L--A--Q--W--R--D--H--H--G--R--C--L--P--P--E--T--E--D-

----------------------------------------------------------------------------------------------------
-I--V--W--D--A--Q--D--L--F--S--L--E--T--S--V--V--V--R--A--G--A--L--S--N--V--S--V--S--I--Q--N--L--L--
ATCGTCTGGGATGCCCAGGACCTGTTCAGTCTGGAAACATCTGTGGTTGTCCGAGCGGGAGCCCTCAGCAATGTGTCCGTCTCCATCCAGAATCTCCTCT
:::.::..:::::::::...:::.::::::.::::::::::::::::..:::.:: ::: .:::  ::::::::: :.  ::::::::::::.:.:::..
ATCATCCAGGATGCCCAAAGCCTATTCAGTTTGGAAACATCTGTGGTCATCCAAGGGGGCACCCAGAGCAATGTGACTTGCTCCATCCAGAACCCCCTTC
-I--I--Q--D--A--Q--S--L--F--S--L--E--T--S--V--V--I--Q--G--G--T--Q--S--N--V--T--C--S--I--Q--N--P--L--

-----------------------------------><---------------------------------------------------------------
L--S--Q--K--K--E--L--V--V--Q--I--A--D--V--F--V--P--G--A--S--A--W--K--S--A--F--V--A--T--L--P--L--L--L
TGAGCCAGAAGAAAGAGTTGGTGGTCCAGATAGCAGACGTGTTCGTACCCGGAGCCTCTGCGTGGAAGAGCGCGTTCGTCGCGACCCTGCCGCTGCTGTT
::.:::::::::::::::: :.:::::::::::::                                                                 
TGGGCCAGAAGAAAGAGTTTGCGGTCCAGATAGCA-----------------------------------------------------------------
L--G--Q--K--K--E--F--A--V--Q--I--A------------------------------------------------------------------

----------------------------------------------------><-------------------------------><-------------
--V--L--A--A--L--A--L--G--V--L--R--K--Q--R--R--S--R--E--K--L--R--K--Q--A--E--K--R--Q--E--K--L--T--A-
GGTCCTCGCGGCGCTGGCGCTGGGCGTCCTCCGGAAGCAGCGGAGAAGCCGAGAAAAGCTGAGGAAGCAGGCGGAGAAGAGACAAGAGAAACTCACTGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------><-------------------><-------------------------><-------------------------><-----------------
-E--L--E--K--L--Q--T--E--L--D--W--R--R--A--E--G--Q--A--E--W--R--A--A--Q--K--Y--A--V--D--V--T--L--D--
GAGCTGGAAAAGCTTCAGACAGAGCTTGACTGGAGACGGGCTGAAGGCCAGGCTGAGTGGAGAGCAGCCCAAAAATATGCAGTGGATGTGACGCTGGACC
                                                                                    :: ::::: :::::.:
------------------------------------------------------------------------------------GAGGTGACCCTGGATC
-------------------------------------------------------------------------------------E--V--T--L--D--

----------------------------------------------------------------------------------------------------
P--A--S--A--H--P--S--L--E--V--S--E--D--G--K--S--V--S--S--R--G--A--P--P--G--P--A--P--G--H--P--Q--R--F
CGGCCTCGGCGCACCCCAGCCTGGAGGTGTCGGAGGATGGCAAGAGCGTGTCTTCCCGCGGGGCGCCGCCAGGCCCGGCGCCTGGCCACCCGCAGCGGTT
: :  :: :: ::::::::::::::::: ::.::.::::::::: :::::::.::::::.::..: :.::::::.::::. :::::::::  ::::.:::
CTGGGTCTGCCCACCCCAGCCTGGAGGTCTCAGAAGATGGCAAGCGCGTGTCCTCCCGCAGGATGGCACCAGGCTCGGCAGCTGGCCACCATCAGCAGTT
P--G--S--A--H--P--S--L--E--V--S--E--D--G--K--R--V--S--S--R--R--M--A--P--G--S--A--A--G--H--H--Q--Q--F

----------------------------------------------------------------------------------------------------
--S--E--Q--T--C--A--L--S--L--E--R--F--S--A--G--R--H--Y--W--E--V--H--V--G--R--R--S--R--W--F--L--G--A-
CTCGGAGCAGACGTGCGCGCTGAGCCTGGAGCGGTTCTCCGCCGGCCGCCACTACTGGGAGGTGCACGTGGGCCGCCGCAGCCGCTGGTTCCTGGGCGCC
:..:::::::::.::::. ::::::: : :::: :::::.::.:::::::::::::::::::::::.:::::::.:::::::::.::::::::.::.:. 
CCTGGAGCAGACATGCGTTCTGAGCCAGCAGCGCTTCTCTGCTGGCCGCCACTACTGGGAGGTGCATGTGGGCCACCGCAGCCGTTGGTTCCTAGGTGTG
--L--E--Q--T--C--V--L--S--Q--Q--R--F--S--A--G--R--H--Y--W--E--V--H--V--G--H--R--S--R--W--F--L--G--V-

----------------------------------------------------------------------------------------------------
-C--L--A--A--V--P--R--A--G--P--A--R--L--S--P--A--A--G--Y--W--V--L--G--L--W--N--G--C--E--Y--F--V--L--
TGCCTGGCCGCGGTGCCGCGCGCGGGGCCTGCGCGCCTGAGCCCTGCGGCCGGCTACTGGGTGCTGGGGCTGTGGAACGGCTGCGAGTACTTCGTCCTGG
:::::::::. ::::: :.:: :.:: :: :.:: :.:::::::::: . .:::::::::::: :::::::::::::.::.:::::::::::.::.::::
TGCCTGGCCAAGGTGCAGTGCTCAGGTCCGGTGCTCTTGAGCCCTGCCAATGGCTACTGGGTGATGGGGCTGTGGAATGGTTGCGAGTACTTTGTTCTGG
-C--L--A--K--V--Q--C--S--G--P--V--L--L--S--P--A--N--G--Y--W--V--M--G--L--W--N--G--C--E--Y--F--V--L--

----------------------------------------------------------------------------------------------------
A--P--H--R--V--A--L--T--L--R--V--P--P--R--R--L--G--V--F--L--D--Y--E--A--G--E--L--S--F--F--N--V--S--D
CCCCGCACCGCGTCGCGCTCACCCTGCGCGTGCCCCCGCGGCGCCTGGGCGTCTTCCTGGACTACGAGGCCGGAGAGCTGTCCTTCTTCAACGTGTCCGA
 .::.:::::::: ::::::::: :::.:::::: :: :::.:: :::::.::::.:::::::..:: :: :::.:::: ::::::::::::::: ::::
ATCCACACCGCGTGGCGCTCACCGTGCACGTGCCACCCCGGTGCGTGGGCATCTTTCTGGACTGTGATGCAGGAAAGCTTTCCTTCTTCAACGTGACCGA
D--P--H--R--V--A--L--T--V--H--V--P--P--R--C--V--G--I--F--L--D--C--D--A--G--K--L--S--F--F--N--V--T--D

----------------------------------------------------------------------------------------------------
--G--S--H--I--F--T--F--H--D--T--F--S--G--A--L--C--A--Y--F--R--P--R--A--H--D--G--G--E--H--P--D--P--L-
CGGCTCCCACATCTTCACCTTCCACGACACCTTCTCGGGCGCGCTCTGTGCGTACTTCAGGCCCAGGGCCCACGACGGCGGCGAACATCCGGATCCCCTG
.:::::::::::.:::::::::  .:::::::::   :. .:.::::::::.::.::.:::::.::.:::::.::.:::.::.::::.::.::::: :: 
TGGCTCCCACATTTTCACCTTCACTGACACCTTCAGCGAGACACTCTGTGCATATTTTAGGCCTAGAGCCCATGATGGCAGCAAACACCCAGATCCACTC
--G--S--H--I--F--T--F--T--D--T--F--S--E--T--L--C--A--Y--F--R--P--R--A--H--D--G--S--K--H--P--D--P--L-

----------------------------------------------------------------------------------------------------
-T--I--C--P--L--P--V--R--G--T--G--V--P--E--E--N--D--S--D--T--W--L--Q--P--Y--E--P--A--D--P--A--L--D--
ACCATCTGCCCGCTGCCGGTTAGAGGGACGGGCGTCCCCGAAGAGAACGACAGTGACACCTGGCTACAGCCCTATGAGCCCGCGGACCCCGCCCTGGACT
:::::::::::..::::.::::::                                                                            
ACCATCTGCCCATTGCCAGTTAGA----------------------------------------------------------------------------
-T--I--C--P--L--P--V--R-----------------------------------------------------------------------------

------->
W--W--*-
GGTGGTGA
        
--------
--------

Pig Consensus Sequence

>BGISUST0000876940
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------CTGGGCTCAGACCCTCACATCTCCCTTGAGGGCTTCAAAGAGGG
AGGCATTCAGCTAAGGTGCAGCTCCAGTGGCTGGTACCCCATGCCGCTGGCTCAGTGGAGAGACCATCATGGACGATGCTTGCCTCCAGAGACTGAAGAC
ATCATCCAGGATGCCCAAAGCCTATTCAGTTTGGAAACATCTGTGGTCATCCAAGGGGGCACCCAGAGCAATGTGACTTGCTCCATCCAGAACCCCCTTC
TGGGCCAGAAGAAAGAGTTTGCGGTCCAGATAGCA-----------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------GAGGTGACCCTGGATC
CTGGGTCTGCCCACCCCAGCCTGGAGGTCTCAGAAGATGGCAAGCGCGTGTCCTCCCGCAGGATGGCACCAGGCTCGGCAGCTGGCCACCATCAGCAGTT
CCTGGAGCAGACATGCGTTCTGAGCCAGCAGCGCTTCTCTGCTGGCCGCCACTACTGGGAGGTGCATGTGGGCCACCGCAGCCGTTGGTTCCTAGGTGTG
TGCCTGGCCAAGGTGCAGTGCTCAGGTCCGGTGCTCTTGAGCCCTGCCAATGGCTACTGGGTGATGGGGCTGTGGAATGGTTGCGAGTACTTTGTTCTGG
ATCCACACCGCGTGGCGCTCACCGTGCACGTGCCACCCCGGTGCGTGGGCATCTTTCTGGACTGTGATGCAGGAAAGCTTTCCTTCTTCAACGTGACCGA
TGGCTCCCACATTTTCACCTTCACTGACACCTTCAGCGAGACACTCTGTGCATATTTTAGGCCTAGAGCCCATGATGGCAGCAAACACCCAGATCCACTC
ACCATCTGCCCATTGCCAGTTAGA----------------------------------------------------------------------------
--------


>BGISUSP0000876940
----------------------------------------------------------------------------------------------------
----------------------------------------------------LGSDPHISLEGFKEGGIQLRCSSSGWYPMPLAQWRDHHGRCLPPETED
IIQDAQSLFSLETSVVIQGGTQSNVTCSIQNPLLGQKKEFAVQIA-------------------------------------------------------
----------------------------EVTLDPGSAHPSLEVSEDGKRVSSRRMAPGSAAGHHQQFLEQTCVLSQQRFSAGRHYWEVHVGHRSRWFLGV
CLAKVQCSGPVLLSPANGYWVMGLWNGCEYFVLDPHRVALTVHVPPRCVGIFLDCDAGKLSFFNVTDGSHIFTFTDTFSETLCAYFRPRAHDGSKHPDPL
TICPLPVR----------------------------