Sequences
EST Library Info
cad1Unavailable
cli1Liver - RNA from China
cly3Lymph - RNA from China
fbs3Unavailable
jca2Joint capsule
nep2Newborn 115 days, epidermis
nlu1Newborn 115 days, lung
pigcb1Unavailable
plac7Unavailable
tes2Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000182985 (click for geneview)
Transcript ID ENST00000328158(link to ensembl)
Symbol IGSF4
Localtion Chromosome:11:114552207:114880322:-1 band: 11q23.3
Description immunoglobulin superfamily, member 4 [Source:RefSeq_peptide;Acc:NP_055148]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--S--V--V--L--P--S--G--S--Q--C--A--A--A--A--A--A--A--A-----------P--P--G--L--R--L--R--L--L--L--
ATGGCGAGTGTAGTGCTGCCGAGCGGATCCCAGTGTGCGGCGGCAGCGGCGGCGGCGGCG---------CCTCCCGGGCTCCGGCTCCGGCTTCTGCTGT
::::::::::. :::::::::::::::.::::::::::::::::.:::::::::::::::         ::::::::::::::.::::::::::::::::
ATGGCGAGTGCTGTGCTGCCGAGCGGACCCCAGTGTGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGCCTCCCGGGCTCCGACTCCGGCTTCTGCTGT
-M--A--S--A--V--L--P--S--G--P--Q--C--A--A--A--A--A--A--A--A--A--A--A--P--P--G--L--R--L--R--L--L--L--

--------------------------------><------------------------------------------------------------------
L--L--F--S--A--A--A--L--I--P--T--G--D--G--Q--N--L--F--T--K--D--V--T--V--I--E--G--E--V--A--T--I--S--C
TGCTCTTCTCCGCCGCGGCACTGATCCCCACAGGTGATGGGCAGAATCTGTTTACGAAAGACGTGACAGTGATCGAGGGAGAGGTTGCGACCATCAGTTG
:::::.::::.:::::::::::::::::::::   :::::.::::::.::::::: ::::::::::::::::::::::: ::.:::::.::::::::.::
TGCTCCTCTCTGCCGCGGCACTGATCCCCACA---GATGGACAGAATTTGTTTACTAAAGACGTGACAGTGATCGAGGGCGAAGTTGCAACCATCAGCTG
L--L--L--S--A--A--A--L--I--P--T-----D--G--Q--N--L--F--T--K--D--V--T--V--I--E--G--E--V--A--T--I--S--C

-------------------------------------------------------------------------------><-------------------
--Q--V--N--K--S--D--D--S--V--I--Q--L--L--N--P--N--R--Q--T--I--Y--F--R--D--F--R--P--L--K--D--S--R--F-
CCAAGTCAATAAGAGTGACGACTCTGTGATTCAGCTACTGAATCCCAACAGGCAGACCATTTATTTCAGGGACTTCAGGCCTTTGAAGGACAGCAGGTTT
:::::::::.::::::::::::::::: ::::::::::::::::::::: :::::::::::::::::::::::::: ::   :::::::::::::::::.
CCAAGTCAACAAGAGTGACGACTCTGTTATTCAGCTACTGAATCCCAACCGGCAGACCATTTATTTCAGGGACTTCCGG---TTGAAGGACAGCAGGTTC
--Q--V--N--K--S--D--D--S--V--I--Q--L--L--N--P--N--R--Q--T--I--Y--F--R--D--F--R-----L--K--D--S--R--F-

----------------------------------------------------------------------------------------------------
-Q--L--L--N--F--S--S--S--E--L--K--V--S--L--T--N--V--S--I--S--D--E--G--R--Y--F--C--Q--L--Y--T--D--P--
CAGTTGCTGAATTTTTCTAGCAGTGAACTCAAAGTATCATTGACAAACGTCTCAATTTCTGATGAAGGAAGATACTTTTGCCAGCTCTATACCGATCCCC
:::.::::::::::::: :::::::::::::::::.::::::::.::.::::::::::::::.::::::::::::::::::::::::::.::.::.::.:
CAGCTGCTGAATTTTTCGAGCAGTGAACTCAAAGTGTCATTGACGAATGTCTCAATTTCTGACGAAGGAAGATACTTTTGCCAGCTCTACACTGACCCTC
-Q--L--L--N--F--S--S--S--E--L--K--V--S--L--T--N--V--S--I--S--D--E--G--R--Y--F--C--Q--L--Y--T--D--P--

--------------------------------><------------------------------------------------------------------
P--Q--E--S--Y--T--T--I--T--V--L--V--P--P--R--N--L--M--I--D--I--Q--K--D--T--A--V--E--G--E--E--I--E--V
CACAGGAAAGTTACACCACCATCACAGTCCTGGTCCCACCACGTAATCTGATGATCGATATCCAGAAAGACACTGCGGTGGAAGGTGAGGAGATTGAAGT
: ::::::::::::::::: ::::::::::::   :::::::::::.::::::::::::::::::::::::::::::::::::::.::::::::::::::
CCCAGGAAAGTTACACCACAATCACAGTCCTG---CCACCACGTAACCTGATGATCGATATCCAGAAAGACACTGCGGTGGAAGGCGAGGAGATTGAAGT
P--Q--E--S--Y--T--T--I--T--V--L-----P--P--R--N--L--M--I--D--I--Q--K--D--T--A--V--E--G--E--E--I--E--V

----------------------------------------------------------------------><----------------------------
--N--C--T--A--M--A--S--K--P--A--T--T--I--R--W--F--K--G--N--T--E--L--K--G--K--S--E--V--E--E--W--S--D-
CAACTGCACTGCTATGGCCAGCAAGCCAGCCACGACTATCAGGTGGTTCAAAGGGAACACAGAGCTAAAAGGCAAATCGGAGGTGGAAGAGTGGTCAGAC
::::::::: ::.:::::::::::::::::::::::.:::::::::::::::::::::: .::::: :::   ::.:::::::::::.::::::::::::
CAACTGCACGGCCATGGCCAGCAAGCCAGCCACGACCATCAGGTGGTTCAAAGGGAACAAGGAGCTCAAA---AAGTCGGAGGTGGAGGAGTGGTCAGAC
--N--C--T--A--M--A--S--K--P--A--T--T--I--R--W--F--K--G--N--K--E--L--K-----K--S--E--V--E--E--W--S--D-

----------------------------------------------------------------------------------------------------
-M--Y--T--V--T--S--Q--L--M--L--K--V--H--K--E--D--D--G--V--P--V--I--C--Q--V--E--H--P--A--V--T--G--N--
ATGTACACTGTGACCAGTCAGCTGATGCTGAAGGTGCACAAGGAGGACGATGGGGTCCCAGTGATCTGCCAGGTGGAGCACCCTGCGGTCACTGGAAACC
:::::::: :::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::.:::::::::::::: :: :::::.:::::::
ATGTACACGGTGACCAGTCAGCTGATGCTGAAGGTGCACAAGGAGGACGATGGCGTCCCAGTGATCTGTCAGGTGGAGCACCCAGCTGTCACCGGAAACC
-M--Y--T--V--T--S--Q--L--M--L--K--V--H--K--E--D--D--G--V--P--V--I--C--Q--V--E--H--P--A--V--T--G--N--

-----------------------------><---------------------------------------------------------------------
L--Q--T--Q--R--Y--L--E--V--Q--Y--K--P--Q--V--H--I--Q--M--T--Y--P--L--Q--G--L--T--R--E--G--D--A--L--E
TGCAGACCCAGCGGTATCTAGAAGTACAGTATAAGCCTCAAGTGCACATTCAGATGACTTATCCTCTACAAGGCTTAACCCGGGAAGGGGACGCGCTTGA
:::::::::::::::::::.:::::::::      :::::::::::.::::::::::::::.::::::::::::.:::::::::::::::::::::::::
TGCAGACCCAGCGGTATCTGGAAGTACAG------CCTCAAGTGCATATTCAGATGACTTACCCTCTACAAGGCCTAACCCGGGAAGGGGACGCGCTTGA
L--Q--T--Q--R--Y--L--E--V--Q--------P--Q--V--H--I--Q--M--T--Y--P--L--Q--G--L--T--R--E--G--D--A--L--E

-----------------------------><---------------------------------------------------------------------
--L--T--C--E--A--I--G--K--P--Q--P--V--M--V--T--W--V--R--V--D--D--E--M--P--Q--H--A--V--L--S--G--P--N-
GTTAACATGTGAAGCCATCGGGAAGCCCCAGCCTGTGATGGTAACTTGGGTGAGAGTCGATGATGAAATGCCTCAACACGCCGTACTGTCTGGGCCCAAC
::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::.::::::::::::::::::::.::::: :::::::::
GTTAACATGTGAAGCCATCGGGAAGCCC---CCTGTGATGGTAACTTGGGTGAGAGTCGATGACGAAATGCCTCAACACGCCGTGCTGTCGGGGCCCAAC
--L--T--C--E--A--I--G--K--P-----P--V--M--V--T--W--V--R--V--D--D--E--M--P--Q--H--A--V--L--S--G--P--N-

----------------------------------------------------------------------------------------------------
-L--F--I--N--N--L--N--K--T--D--N--G--T--Y--R--C--E--A--S--N--I--V--G--K--A--H--S--D--Y--M--L--Y--V--
CTGTTCATCAATAACCTAAACAAAACAGATAATGGTACATACCGCTGTGAAGCTTCAAACATAGTGGGGAAAGCTCACTCGGATTATATGCTGTATGTAT
:::::::::::::::::::::::::::::::::::::: :::::::::::.::::::::::::::::::::.:::::.::::::::::::::::::::::
CTGTTCATCAATAACCTAAACAAAACAGATAATGGTACCTACCGCTGTGAGGCTTCAAACATAGTGGGGAAGGCTCATTCGGATTATATGCTGTATGTAT
-L--F--I--N--N--L--N--K--T--D--N--G--T--Y--R--C--E--A--S--N--I--V--G--K--A--H--S--D--Y--M--L--Y--V--

--><-------------------------------><----------------------------------------------------><---------
Y--D--T--T--A--T--T--E--P--A--V--H--G--L--T--Q--L--P--N--S--A--E--E--L--D--S--E--D--L--S--D--S--R--A
ACGACACAACGGCGACGACAGAACCAGCAGTTCACGGCCTTACTCAGTTGCCCAATTCCGCAGAAGAACTGGACAGTGAGGACCTCTCAGATTCCCGAGC
::                                    :::::::::::::::::::::::::::::::::::::::::::::::::::   ::.:::::
AC------------------------------------CTTACTCAGTTGCCCAATTCCGCAGAAGAACTGGACAGTGAGGACCTCTCA---TCTCGAGC
Y--------------------------------------L--T--Q--L--P--N--S--A--E--E--L--D--S--E--D--L--S-----S--R--A

----------------------------------------------------------------------------------------------------
--G--E--E--G--S--I--R--A--V--D--H--A--V--I--G--G--V--V--A--V--V--V--F--A--M--L--C--L--L--I--I--L--G-
AGGTGAAGAAGGCTCGATCAGGGCAGTGGATCATGCCGTGATCGGTGGCGTCGTGGCGGTGGTGGTGTTCGCCATGCTGTGCTTGCTCATCATTCTGGGG
::::::::::::::: ::::::::.::::::::.::::::::.::.:::::::::::::::::::::::.:::::::::::.:::::::::::.::::::
AGGTGAAGAAGGCTCCATCAGGGCGGTGGATCACGCCGTGATTGGCGGCGTCGTGGCGGTGGTGGTGTTTGCCATGCTGTGTTTGCTCATCATCCTGGGG
--G--E--E--G--S--I--R--A--V--D--H--A--V--I--G--G--V--V--A--V--V--V--F--A--M--L--C--L--L--I--I--L--G-

---------------------><-----------------------------------------------------------------------------
-R--Y--F--A--R--H--K--G--T--Y--F--T--H--E--A--K--G--A--D--D--A--A--D--A--D--T--A--I--I--N--A--E--G--
CGCTATTTTGCCAGACATAAAGGTACATACTTCACTCATGAAGCCAAAGGAGCCGATGACGCAGCAGACGCAGACACAGCTATAATCAATGCAGAAGGAG
:::::::::::::::::::::   :::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::
CGCTATTTTGCCAGACATAAA---ACATACTTCACTCATGAAGCCAAAGGAGCCGATGATGCAGCAGACGCAGACACAGCTATAATCAATGCAGAAGGAG
-R--Y--F--A--R--H--K-----T--Y--F--T--H--E--A--K--G--A--D--D--A--A--D--A--D--T--A--I--I--N--A--E--G--

---------------------------------------->
G--Q--N--N--S--E--E--K--K--E--Y--F--I--*-
GACAGAACAACTCCGAAGAAAAGAAAGAGTACTTCATCTAG
:::::::::::::.:::::::::::::::::::::::::::
GACAGAACAACTCTGAAGAAAAGAAAGAGTACTTCATCTAG
G--Q--N--N--S--E--E--K--K--E--Y--F--I--*-

Pig Consensus Sequence

>BGISUST0000897055
ATGGCGAGTGCTGTGCTGCCGAGCGGACCCCAGTGTGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGCCTCCCGGGCTCCGACTCCGGCTTCTGCTGT
TGCTCCTCTCTGCCGCGGCACTG---GATGGACAGAATTTGTTTACTAAAGACGTGACAGTGATCGAGGGCGAAGTTGCAACCATCAGCTGCCAAGTCAA
CAAGAGTGACGACTCTGTTATTCAGCTACTGAATCCCAACCGGCAGACCATTTATTTCAGGGACTTCCGG---TTGAAGGACAGCAGGTTCCAGCTGCTG
AATTTTTCGAGCAGTGAACTCAAAGTGTCATTGACGAATGTCTCAATTTCTGACGAAGGAAGATACTTTTGCCAGCTCTACACTGACCCTCCCCAGGAAA
GTTACACCACAATCACAGTCCTG---CCACCACGTAACCTGATGATCGATATCCAGAAAGACACTGCGGTGGAAGGCGAGGAGATTGAAGTCAACTGCAC
GGCCATGGCCAGCAAGCCAGCCACGACCATCAGGTGGTTCAAAGGGAACAAGGAGCTCAAA---AAGTCGGAGGTGGAGGAGTGGTCAGACATGTACACG
GTGACCAGTCAGCTGATGCTGAAGGTGCACAAGGAGGACGATGGCGTCCCAGTGATCTGTCAGGTGGAGCACCCAGCTGTCACCGGAAACCTGCAGACCC
AGCGGTATCTGGAAGTACAG------CCTCAAGTGCATATTCAGATGACTTACCCTCTACAAGGCCTAACCCGGGAAGGGGACGCGCTTGAGTTAACATG
TGAAGCCATCGGGAAGCCC---CCTGTGATGGTAACTTGGGTGAGAGTCGATGACGAAATGCCTCAACACGCCGTGCTGTCGGGGCCCAACCTGTTCATC
AATAACCTAAACAAAACAGATAATGGTACCTACCGCTGTGAGGCTTCAAACATAGTGGGGAAGGCTCATTCGGATTATATGCTGTATGTATAC-------
-----------------------------CTTACTCAGTTGCCCAATTCCGCAGAAGAACTGGACAGTGAGGACCTCTCA---TCTCGAGCAGGTGAAGA
AGGCTCCATCAGGGCGGTGGATCACGCCGTGATTGGCGGCGTCGTGGCGGTGGTGGTGTTTGCCATGCTGTGTTTGCTCATCATCCTGGGGCGCTATTTT
GCCAGACATAAA---ACATACTTCACTCATGAAGCCAAAGGAGCCGATGATGCAGCAGACGCAGACACAGCTATAATCAATGCAGAAGGAGGACAGAACA
ACTCTGAAGAAAAGAAAGAGTACTTCATCTAG


>BGISUSP0000897055
MASAVLPSGPQCAAAAAAAAAAAPPGLRLRLLLLLLSAAAL-DGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFR-LKDSRFQLL
NFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVL-PPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELK-KSEVEEWSDMYT
VTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQ--PQVHIQMTYPLQGLTREGDALELTCEAIGKP-PVMVTWVRVDDEMPQHAVLSGPNLFI
NNLNKTDNGTYRCEASNIVGKAHSDYMLYVY------------LTQLPNSAEELDSEDLS-SRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYF
ARHK-TYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI*