Sequences
EST Library Info
csp3Spleen - RNA from China
fcc2Unavailable
med1Mediastinum
pigca1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000156873 (click for geneview)
Transcript ID ENST00000328273(link to ensembl)
Symbol PHKG2
Localtion Chromosome:16:30667238:30676183:1 band: 16p11.2
Description Phosphorylase b kinase gamma catalytic chain, testis/liver isoform (EC 2.7.1.38) (PHK-gamma-T) (Phosphorylase kinase gamma subunit 2) (PSK-C3). [Source:Uniprot/SWISSPROT;Acc:P15735]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------><----
-M--T--L--D--V--G--P--E--D--E--L--P--D--W--A--A--A--K--E--F--Y--Q--K--Y--D--P--K--D--V--I--G--R--G--
ATGACGCTGGACGTGGGGCCGGAGGATGAGCTGCCCGACTGGGCCGCCGCCAAAGAGTTTTACCAGAAGTACGACCCTAAGGACGTCATCGGCAGAGGAG
:::::::::::::::::.::.:::::::::::::::::::::::.:: :::::.:::::::::::::::::::::::::::::::::::.:::   ::::
ATGACGCTGGACGTGGGACCAGAGGATGAGCTGCCCGACTGGGCTGCGGCCAAGGAGTTTTACCAGAAGTACGACCCTAAGGACGTCATTGGC---GGAG
-M--T--L--D--V--G--P--E--D--E--L--P--D--W--A--A--A--K--E--F--Y--Q--K--Y--D--P--K--D--V--I--G-----G--

----------------------------------------------------------------------------------------------------
V--S--S--V--V--R--R--C--V--H--R--A--T--G--H--E--F--A--V--K--I--M--E--V--T--A--E--R--L--S--P--E--Q--L
TGAGCTCTGTGGTCCGCCGTTGTGTTCATCGAGCTACTGGCCACGAGTTTGCGGTGAAGATTATGGAAGTGACAGCTGAGCGGCTGAGTCCTGAGCAGCT
::::::::::::::::::::::.:: :::::::::::::::...:::::::::::::::::.:::::.::::::::.::::: ::::::::.::::::::
TGAGCTCTGTGGTCCGCCGTTGCGTGCATCGAGCTACTGGCTGTGAGTTTGCGGTGAAGATCATGGAGGTGACAGCCGAGCGCCTGAGTCCCGAGCAGCT
V--S--S--V--V--R--R--C--V--H--R--A--T--G--C--E--F--A--V--K--I--M--E--V--T--A--E--R--L--S--P--E--Q--L

----------------------------------------------------------------------><----------------------------
--E--E--V--R--E--A--T--R--R--E--T--H--I--L--R--Q--V--A--G--H--P--H--I--I--T--L--I--D--S--Y--E--S--S-
GGAGGAGGTGCGGGAAGCCACACGGCGAGAGACACACATCCTTCGCCAGGTCGCCGGCCACCCCCACATCATCACCCTCATCGATTCCTACGAGTCTTCT
::::::::::::.::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::   ::.::::::::::::::::::::::::
GGAGGAGGTGCGAGAAGCCACGCGGCGAGAGACGCACATCCTTCGCCAGGTCGCCGGCCACCCCCACATC---ACTCTCATCGATTCCTACGAGTCTTCT
--E--E--V--R--E--A--T--R--R--E--T--H--I--L--R--Q--V--A--G--H--P--H--I-----T--L--I--D--S--Y--E--S--S-

-------------------------><----------------------------------------------------------------><-------
-S--F--M--F--L--V--F--D--L--M--R--K--G--E--L--F--D--Y--L--T--E--K--V--A--L--S--E--K--E--T--R--S--I--
AGCTTCATGTTCCTGGTGTTTGACCTGATGCGGAAGGGAGAGCTGTTTGACTATCTCACAGAGAAGGTGGCCCTCTCTGAAAAGGAAACCAGGTCCATCA
::::::::::::::::::::::::   :::::::::::.::::::::::::::::::::::::::::::::::: :: ::::::::::::   :::::::
AGCTTCATGTTCCTGGTGTTTGAC---ATGCGGAAGGGGGAGCTGTTTGACTATCTCACAGAGAAGGTGGCCCTGTCAGAAAAGGAAACC---TCCATCA
-S--F--M--F--L--V--F--D-----M--R--K--G--E--L--F--D--Y--L--T--E--K--V--A--L--S--E--K--E--T-----S--I--

----------------------------------------------------------------------------------------------------
M--R--S--L--L--E--A--V--S--F--L--H--A--N--N--I--V--H--R--D--L--K--P--E--N--I--L--L--D--D--N--M--Q--I
TGCGGTCTCTGCTGGAAGCAGTGAGCTTTCTCCATGCCAACAACATTGTGCATCGAGATCTGAAGCCCGAGAATATTCTCCTAGATGACAATATGCAGAT
::::::::::::::::.:::::::::::::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::::::::.::::::::
TGCGGTCTCTGCTGGAGGCAGTGAGCTTTCTCCATGCCAACAACATTGTGCACCGAGACCTGAAGCCCGAGAATATTCTCCTAGATGACAACATGCAGAT
M--R--S--L--L--E--A--V--S--F--L--H--A--N--N--I--V--H--R--D--L--K--P--E--N--I--L--L--D--D--N--M--Q--I

-------------------------------------------------------><-------------------------------------------
--R--L--S--D--F--G--F--S--C--H--L--E--P--G--E--K--L--R--E--L--C--G--T--P--G--Y--L--A--P--E--I--L--K-
CCGACTTTCAGATTTCGGGTTCTCCTGCCACTTGGAACCTGGCGAGAAGCTTCGAGAGTTGTGTGGGACCCCAGGGTATCTAGCGCCAGAGATCCTTAAA
:::::::::::::::.::::::::::::::::::::::::::::::::::: :::   .::::.:::::.::::: ::::::::.::.::::::::.::.
CCGACTTTCAGATTTTGGGTTCTCCTGCCACTTGGAACCTGGCGAGAAGCTGCGA---CTGTGCGGGACTCCAGGCTATCTAGCACCGGAGATCCTCAAG
--R--L--S--D--F--G--F--S--C--H--L--E--P--G--E--K--L--R-----L--C--G--T--P--G--Y--L--A--P--E--I--L--K-

----------------------------------------------><----------------------------------------------------
-C--S--M--D--E--T--H--P--G--Y--G--K--E--V--D--L--W--A--C--G--V--I--L--F--T--L--L--A--G--S--P--P--F--
TGCTCCATGGATGAAACCCACCCAGGCTATGGCAAGGAGGTCGACCTCTGGGCCTGTGGGGTGATCTTGTTCACACTCCTGGCTGGCTCGCCACCCTTCT
:::::::::::::::::::::::::::::.::::.::::::::::   ::::::::::::::::::::::::::.:::::::::::::::::::: ::::
TGCTCCATGGATGAAACCCACCCAGGCTACGGCAGGGAGGTCGAC---TGGGCCTGTGGGGTGATCTTGTTCACGCTCCTGGCTGGCTCGCCACCATTCT
-C--S--M--D--E--T--H--P--G--Y--G--R--E--V--D-----W--A--C--G--V--I--L--F--T--L--L--A--G--S--P--P--F--

----------------------------------------------------------------------------------------------------
W--H--R--R--Q--I--L--M--L--R--M--I--M--E--G--Q--Y--Q--F--S--S--P--E--W--D--D--R--S--S--T--V--K--D--L
GGCACCGGCGGCAGATCCTGATGTTACGCATGATCATGGAGGGCCAGTACCAGTTCAGTTCCCCCGAGTGGGATGACCGTTCCAGCACTGTCAAAGACCT
:::::::::: ::::::::::::::::::::::::::::::::::::::::::::.::::: :::::.:::::.:::::::::..:::.:::::::::::
GGCACCGGCGCCAGATCCTGATGTTACGCATGATCATGGAGGGCCAGTACCAGTTTAGTTCACCCGAATGGGACGACCGTTCCGACACCGTCAAAGACCT
W--H--R--R--Q--I--L--M--L--R--M--I--M--E--G--Q--Y--Q--F--S--S--P--E--W--D--D--R--S--D--T--V--K--D--L

><--------------------------------------------------------------------------------------------------
--I--S--R--L--L--Q--V--D--P--E--A--R--L--T--A--E--Q--A--L--Q--H--P--F--F--E--R--C--E--G--S--Q--P--W-
GATCTCCAGGCTGCTGCAGGTGGATCCTGAGGCACGCCTGACAGCTGAGCAGGCCCTACAGCACCCCTTCTTTGAGCGTTGTGAAGGCAGCCAACCCTGG
:::::: :.:::::::::::::::::: :::: .:::::::::::::::::.::::: :::::::: :::::::::::.::. :.::::::::.::::::
GATCTCGAAGCTGCTGCAGGTGGATCCGGAGGAGCGCCTGACAGCTGAGCAAGCCCTCCAGCACCCGTTCTTTGAGCGCTGCCAGGGCAGCCAGCCCTGG
--I--S--K--L--L--Q--V--D--P--E--E--R--L--T--A--E--Q--A--L--Q--H--P--F--F--E--R--C--Q--G--S--Q--P--W-

--------------------------><------------------------------------------------------------------------
-N--L--T--P--R--Q--R--F--R--V--A--V--W--T--V--L--A--A--G--R--V--A--L--S--T--H--R--V--R--P--L--T--K--
AACCTCACCCCCCGCCAGCGGTTCCGGGTGGCAGTGTGGACAGTGCTGGCTGCTGGACGAGTGGCCCTAAGCACCCATCGTGTACGGCCACTGACCAAGA
::::::::::::::::::::::::::::::::::::::::::::::::::.:::::.::.::::::.:.::..::::.::::: ::::::::::::::::
AACCTCACCCCCCGCCAGCGGTTCCGGGTGGCAGTGTGGACAGTGCTGGCCGCTGGGCGGGTGGCCTTGAGTGCCCACCGTGTCCGGCCACTGACCAAGA
-N--L--T--P--R--Q--R--F--R--V--A--V--W--T--V--L--A--A--G--R--V--A--L--S--A--H--R--V--R--P--L--T--K--

----------------------------------------------------------------------------------------------------
N--A--L--L--R--D--P--Y--A--L--R--S--V--R--H--L--I--D--N--C--A--F--R--L--Y--G--H--W--V--K--K--G--E--Q
ATGCACTGTTGAGGGACCCTTATGCGCTGCGGTCAGTGCGGCACCTCATCGACAACTGTGCCTTCCGGCTCTACGGGCACTGGGTAAAGAAAGGGGAGCA
.::: ::::::::::::::.::.::::::::..:.:::::::.:::::::::::.::::::::::::::::::.::.::::::::.:::::.:: :::::
GTGCTCTGTTGAGGGACCCCTACGCGCTGCGACCGGTGCGGCGCCTCATCGACAGCTGTGCCTTCCGGCTCTATGGACACTGGGTGAAGAAGGGTGAGCA
S--A--L--L--R--D--P--Y--A--L--R--P--V--R--R--L--I--D--S--C--A--F--R--L--Y--G--H--W--V--K--K--G--E--Q

----------------------------------------------------------------------------------------------------
--Q--N--R--A--A--L--F--Q--H--R--P--P--G--P--F--P--I--M--G--P--E--E--E--G--D--S--A--A--I--T--E--D--E-
GCAGAACCGGGCGGCTCTCTTTCAGCACCGGCCCCCTGGGCCTTTTCCCATCATGGGCCCTGAAGAGGAGGGAGACTCTGCTGCTATAACTGAGGATGAG
::::::::::::.::.:::::.:::::::::::::::::::::::.::::: :::: :::::::::::::::.::::: :. .::::  : :::::.:::
GCAGAACCGGGCAGCCCTCTTCCAGCACCGGCCCCCTGGGCCTTTCCCCATGATGGCCCCTGAAGAGGAGGGGGACTCAGTGACTATCCCAGAGGACGAG
--Q--N--R--A--A--L--F--Q--H--R--P--P--G--P--F--P--M--M--A--P--E--E--E--G--D--S--V--T--I--P--E--D--E-

-------------------->
-A--V--L--V--L--G--*-
GCCGTGCTTGTGCTGGGCTAG
:::.:::: ::::::::::::
GCCATGCTGGTGCTGGGCTAG
-A--M--L--V--L--G--*-

Pig Consensus Sequence

>BGISUST0000894661
ATGACGCTGGACGTGGGACCAGAGGATGAGCTGCCCGACTGGGCTGCGGCCAAGGAGTTTTACCAGAAGTACGACCCTAAGGACGTCATTGGC---GGAG
TGAGCTCTGTGGTCCGCCGTTGCGTGCATCGAGCTACTGGCTGTGAGTTTGCGGTGAAGATCATGGAGGTGACAGCCGAGCGCCTGAGTCCCGAGCAGCT
GGAGGAGGTGCGAGAAGCCACGCGGCGAGAGACGCACATCCTTCGCCAGGTCGCCGGCCACCCCCACATC---ACTCTCATCGATTCCTACGAGTCTTCT
AGCTTCATGTTCCTGGTGTTTGAC---ATGCGGAAGGGGGAGCTGTTTGACTATCTCACAGAGAAGGTGGCCCTGTCAGAAAAGGAAACC---TCCATCA
TGCGGTCTCTGCTGGAGGCAGTGAGCTTTCTCCATGCCAACAACATTGTGCACCGAGACCTGAAGCCCGAGAATATTCTCCTAGATGACAACATGCAGAT
CCGACTTTCAGATTTTGGGTTCTCCTGCCACTTGGAACCTGGCGAGAAGCTGCGA---CTGTGCGGGACTCCAGGCTATCTAGCACCGGAGATCCTCAAG
TGCTCCATGGATGAAACCCACCCAGGCTACGGCAGGGAGGTCGAC---TGGGCCTGTGGGGTGATCTTGTTCACGCTCCTGGCTGGCTCGCCACCATTCT
GGCACCGGCGCCAGATCCTGATGTTACGCATGATCATGGAGGGCCAGTACCAGTTTAGTTCACCCGAATGGGACGACCGTTCCGACACCGTCAAAGACCT
GATCTCGAAGCTGCTGCAGGTGGATCCGGAGGAGCGCCTGACAGCTGAGCAAGCCCTCCAGCACCCGTTCTTTGAGCGCTGCCAGGGCAGCCAGCCCTGG
AACCTCACCCCCCGCCAGCGGTTCCGGGTGGCAGTGTGGACAGTGCTGGCCGCTGGGCGGGTGGCCTTGAGTGCCCACCGTGTCCGGCCACTGACCAAGA
GTGCTCTGTTGAGGGACCCCTACGCGCTGCGACCGGTGCGGCGCCTCATCGACAGCTGTGCCTTCCGGCTCTATGGACACTGGGTGAAGAAGGGTGAGCA
GCAGAACCGGGCAGCCCTCTTCCAGCACCGGCCCCCTGGGCCTTTCCCCATGATGGCCCCTGAAGAGGAGGGGGACTCAGTGACTATCCCAGAGGACGAG
GCCATGCTGGTGCTGGGCTAG


>BGISUSP0000894661
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIG-GVSSVVRRCVHRATGCEFAVKIMEVTAERLSPEQLEEVREATRRETHILRQVAGHPHI-TLIDSYESS
SFMFLVFD-MRKGELFDYLTEKVALSEKET-SIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEPGEKLR-LCGTPGYLAPEILK
CSMDETHPGYGREVD-WACGVILFTLLAGSPPFWHRRQILMLRMIMEGQYQFSSPEWDDRSDTVKDLISKLLQVDPEERLTAEQALQHPFFERCQGSQPW
NLTPRQRFRVAVWTVLAAGRVALSAHRVRPLTKSALLRDPYALRPVRRLIDSCAFRLYGHWVKKGEQQNRAALFQHRPPGPFPMMAPEEEGDSVTIPEDE
AMLVLG*