Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000182613 (click for geneview)
Transcript ID ENST00000328275(link to ensembl)
Symbol OR2V2
Localtion Chromosome:5:180514549:180515496:1 band: 5q35.3
Description Olfactory receptor 2V2.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--T--W--V--N--Q--S--Y--T--D--G--F--F--L--L--G--I--F--S--H--S--T--A--D--L--V--L--F--S--V--V--M--
ATGGAGACGTGGGTGAACCAGTCCTACACAGATGGCTTCTTCCTCTTAGGCATCTTCTCCCACAGTACTGCTGACCTTGTCCTCTTCTCCGTGGTTATGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--V--F--T--V--A--L--C--G--N--V--L--L--I--F--L--I--Y--M--D--P--H--L--H--T--P--M--Y--F--F--L--S--Q--L
CGGTCTTCACAGTGGCCCTCTGTGGGAATGTCCTCCTCATCTTCCTCATCTACATGGACCCTCACCTTCACACCCCCATGTACTTCTTCCTCAGCCAGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--L--M--D--L--M--L--V--C--T--N--V--P--K--M--A--A--N--F--L--S--G--R--K--S--I--S--F--V--G--C--G--I-
CTCCCTCATGGACCTCATGTTGGTCTGTACCAATGTGCCAAAGATGGCAGCCAACTTCCTGTCTGGCAGGAAGTCCATCTCCTTTGTGGGCTGTGGCATA
                                                       ::::: ::::: :.::::::.:::::.:::.::::.:::::::::
-------------------------------------------------------TTCCTCTCTGGAAAGAAGTCTATCTCTTTTATGGGTTGTGGCATA
--------------------------------------------------------F--L--S--G--K--K--S--I--S--F--M--G--C--G--I-

----------------------------------------------------------------------------------------------------
-Q--I-----G--L--F--V--C--L--V--G--S--E--G--L--L--L--G--L--M--A--Y--D--R--Y--V--A--I--S--H--P--L--H--
CAAATT---GGCCTCTTTGTCTGTCTTGTGGGATCTGAGGGGCTCTTGCTGGGACTCATGGCTTATGACCGCTATGTGGCCATTAGCCACCCACTTCACT
: : :.   :::.:.::..::: :::.:::::::::::.:::::::.:::::::::::::::::::::::::::::::::::::: ::::::::::::::
CCATTCT--GGCTTTTTCATCTCTCTCGTGGGATCTGAAGGGCTCTCGCTGGGACTCATGGCTTATGACCGCTATGTGGCCATTACCCACCCACTTCACT
-P--F--\--G--F--F--I--S--L--V--G--S--E--G--L--S--L--G--L--M--A--Y--D--R--Y--V--A--I--T--H--P--L--H--

----------------------------------------------------------------------------------------------------
Y--P--I--L--M--N--Q--R--V--C--L--Q--I--T--G--S--S--W--A--F--G--I--I--D--G--L--I--Q--M--V--V--V--M--N
ATCCCATCCTCATGAATCAGAGGGTCTGTCTCCAGATTACTGGGAGCTCCTGGGCCTTTGGGATAATCGATGGCTTGATCCAGATGGTGGTAGTAATGAA
:::::::::::::::.:::: :.:::::::::::::::..:::::::::::::::::::::::: :: :::::.:: :. ::::::::::::::::::: 
ATCCCATCCTCATGAGTCAGCGAGTCTGTCTCCAGATTGTTGGGAGCTCCTGGGCCTTTGGGATCATAGATGGTTTCACACAGATGGTGGTAGTAATGAC
Y--P--I--L--M--S--Q--R--V--C--L--Q--I--V--G--S--S--W--A--F--G--I--I--D--G--F--T--Q--M--V--V--V--M--T

----------------------------------------------------------------------------------------------------
--F--P--Y--C--G--L--R--K--V--N--H--F--F--C--E--M--L--S--L--L--K--L--A--C--V--D--T--S--L--F--E--K--V-
TTTCCCCTACTGTGGCTTGAGGAAGGTGAACCATTTCTTCTGTGAGATGCTATCCTTGTTGAAGCTGGCCTGTGTAGACACATCCCTGTTTGAGAAGGTG
.::.::.:::::::::::::::.:::::.::::.:::::.:::::.:::.::::.:::::::::::::::::::.:::::::::: : :::::::: .::
CTTTCCTTACTGTGGCTTGAGGGAGGTGGACCACTTCTTTTGTGAAATGTTATCTTTGTTGAAGCTGGCCTGTGCAGACACATCCATTTTTGAGAACATG
--F--P--Y--C--G--L--R--E--V--D--H--F--F--C--E--M--L--S--L--L--K--L--A--C--A--D--T--S--I--F--E--N--M-

----------------------------------------------------------------------------------------------------
-I--F--A--C--C--V--F--M--L--L--F--P--F--S--I--I--V--A--S--Y--A--H--I--L--G--T--V--L--Q--M--H--S--A--
ATATTTGCTTGCTGTGTCTTCATGCTTCTCTTCCCATTCTCCATCATCGTGGCCTCCTATGCTCACATTCTAGGGACTGTGCTGCAAATGCACTCTGCTC
:::::::.:::::::::: ::::::: .:..:.:: ::::::::::::::::::::::::::::.:::.::...:.:::::::::: ::::..:::::::
ATATTTGTTTGCTGTGTCATCATGCTGTTTCTTCCCTTCTCCATCATCGTGGCCTCCTATGCTCGCATCCTGAAGGCTGTGCTGCACATGCGTTCTGCTC
-I--F--V--C--C--V--I--M--L--F--L--P--F--S--I--I--V--A--S--Y--A--R--I--L--K--A--V--L--H--M--R--S--A--

----------------------------------------------------------------------------------------------------
Q--A--W--K--K--A--L--A--T--C--S--S--H--L--T--A--V--T--L--F--Y--G--A--A--M--F--I--Y--L--R--P--R--H--Y
AGGCCTGGAAAAAGGCCCTGGCCACCTGCTCCTCCCACCTGACAGCTGTCACCCTCTTCTATGGGGCAGCCATGTTCATCTACCTGAGGCCTAGGCACTA
::::. : ::::::::.::::::::::::::::::::::::::::::::  :::::::::::::::::::::::::::::::::::::.:::::::.:::
AGGCTGGTAAAAAGGCTCTGGCCACCTGCTCCTCCCACCTGACAGCTGTGTCCCTCTTCTATGGGGCAGCCATGTTCATCTACCTGAGACCTAGGCGCTA
Q--A--G--K--K--A--L--A--T--C--S--S--H--L--T--A--V--S--L--F--Y--G--A--A--M--F--I--Y--L--R--P--R--R--Y

----------------------------------------------------------------------------------------------------
--R--A--P--S--H--D--K--V--A--S--I--F--Y--T--V--L--T--P--M--L--N--P--L--I--Y--S--L--R--N--R--E--V--M-
CCGGGCCCCCAGCCATGACAAGGTGGCCTCTATCTTCTACACGGTCCTTACTCCCATGCTCAACCCCCTCATTTACAGCTTGAGGAACAGGGAGGTGATG
:::.::::: ::::::::::::::::.::::::::::::::::::::::::::: :::::::::::.::::::::.:::::::::::: :::::::::::
CCGAGCCCCAAGCCATGACAAGGTGGTCTCTATCTTCTACACGGTCCTTACTCCAATGCTCAACCCTCTCATTTATAGCTTGAGGAACCGGGAGGTGATG
--R--A--P--S--H--D--K--V--V--S--I--F--Y--T--V--L--T--P--M--L--N--P--L--I--Y--S--L--R--N--R--E--V--M-

-------------------------------------------------->
-G--A--L--R--K--G--L--D--R--C--R--I--G--S--Q--H--*-
GGGGCACTGAGGAAGGGGCTGGACCGCTGCAGGATCGGCAGCCAGCACTGA
::.:: ::::::::::::::: :.:..::::: :..: ::.::::.:::::
GGAGCCCTGAGGAAGGGGCTGTATCATTGCAGTACTGTCAACCAGTACTGA
-G--A--L--R--K--G--L--Y--H--C--S--T--V--N--Q--Y--*-

Pig Consensus Sequence

>BGISUST0000893447
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------TTCCTCTCTGGAAAGAAGTCTATCTCTTTTATGGGTTGTGGCATA
CCATTcgGCTTTTTCATCTCTCTCGTGGGATCTGAAGGGCTCTCGCTGGGACTCATGGCTTATGACCGCTATGTGGCCATTACCCACCCACTTCACTATC
CCATCCTCATGAGTCAGCGAGTCTGTCTCCAGATTGTTGGGAGCTCCTGGGCCTTTGGGATCATAGATGGTTTCACACAGATGGTGGTAGTAATGACCTT
TCCTTACTGTGGCTTGAGGGAGGTGGACCACTTCTTTTGTGAAATGTTATCTTTGTTGAAGCTGGCCTGTGCAGACACATCCATTTTTGAGAACATGATA
TTTGTTTGCTGTGTCATCATGCTGTTTCTTCCCTTCTCCATCATCGTGGCCTCCTATGCTCGCATCCTGAAGGCTGTGCTGCACATGCGTTCTGCTCAGG
CTGGTAAAAAGGCTCTGGCCACCTGCTCCTCCCACCTGACAGCTGTGTCCCTCTTCTATGGGGCAGCCATGTTCATCTACCTGAGACCTAGGCGCTACCG
AGCCCCAAGCCATGACAAGGTGGTCTCTATCTTCTACACGGTCCTTACTCCAATGCTCAACCCTCTCATTTATAGCTTGAGGAACCGGGAGGTGATGGGA
GCCCTGAGGAAGGGGCTGTATCATTGCAGTACTGTCAACCAGTACTGA


>BGISUSP0000893447
-------------------------------------------------------------------------------------FLSGKKSISFMGCGI
PFGFFISLVGSEGLSLGLMAYDRYVAITHPLHYPILMSQRVCLQIVGSSWAFGIIDGFTQMVVVMTFPYCGLREVDHFFCEMLSLLKLACADTSIFENMI
FVCCVIMLFLPFSIIVASYARILKAVLHMRSAQAGKKALATCSSHLTAVSLFYGAAMFIYLRPRRYRAPSHDKVVSIFYTVLTPMLNPLIYSLRNREVMG
ALRKGLYHCSTVNQY*