Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000183840 (click for geneview)
Transcript ID ENST00000329321(link to ensembl)
Symbol GPR39
Localtion Chromosome:2:133008348:133237859:1 band: 2q21.2
Description Putative G-protein coupled receptor 39. [Source:Uniprot/SWISSPROT;Acc:O43194]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--S--P--S--L--P--G--S--D--C--S--Q--I--I--D--H--S--H--V--P--E--F--E--V--A--T--W--I--K--I--T--L--
ATGGCTTCACCCAGCCTCCCGGGCAGTGACTGCTCCCAAATCATTGATCACAGTCATGTCCCCGAGTTTGAGGTGGCCACCTGGATCAAAATCACCCTTA
:::::::::::::::: ::: ::::.:::::::::::: .:.:::::::::::.:::::.::.::.::.:::::.::.::::::::::::::::: ::.:
ATGGCTTCACCCAGCCGCCCCGGCAATGACTGCTCCCATGTTATTGATCACAGCCATGTTCCTGAATTCGAGGTAGCTACCTGGATCAAAATCACACTCA
-M--A--S--P--S--R--P--G--N--D--C--S--H--V--I--D--H--S--H--V--P--E--F--E--V--A--T--W--I--K--I--T--L--

----------------------------------------------------------------------------------------------------
I--L--V--Y--L--I--I--F--V--M--G--L--L--G--N--S--A--T--I--R--V--T--Q--V--L--Q--K--K--G--Y--L--Q--K--E
TTCTGGTGTACCTGATCATCTTCGTGATGGGCCTTCTGGGGAACAGCGCCACCATTCGGGTCACCCAGGTGCTGCAGAAGAAAGGATACTTGCAGAAGGA
:.::. ::: ::::.:::::::.:::.::::: :.::::::::.::.:.::: :::::::::::::::::::::::::::::::: :::.::::::::::
TCCTACTGTTCCTGGTCATCTTTGTGGTGGGCATCCTGGGGAATAGTGTCACGATTCGGGTCACCCAGGTGCTGCAGAAGAAAGGCTACCTGCAGAAGGA
I--L--L--F--L--V--I--F--V--V--G--I--L--G--N--S--V--T--I--R--V--T--Q--V--L--Q--K--K--G--Y--L--Q--K--E

----------------------------------------------------------------------------------------------------
--V--T--D--H--M--V--S--L--A--C--S--D--I--L--V--F--L--I--G--M--P--M--E--F--Y--S--I--I--W--N--P--L--T-
GGTGACAGACCACATGGTGAGTTTGGCTTGCTCGGACATCTTGGTGTTCCTCATCGGCATGCCCATGGAGTTCTACAGCATCATCTGGAATCCCCTGACC
:::::::::::::::::::::..:::::::::: ::::::.:::: ::::::::.::.::::::.:::::::::::::::::::::::::.:::::::::
GGTGACAGACCACATGGTGAGCCTGGCTTGCTCCGACATCCTGGTCTTCCTCATTGGTATGCCCGTGGAGTTCTACAGCATCATCTGGAACCCCCTGACC
--V--T--D--H--M--V--S--L--A--C--S--D--I--L--V--F--L--I--G--M--P--V--E--F--Y--S--I--I--W--N--P--L--T-

----------------------------------------------------------------------------------------------------
-T--S--S--Y--T--L--S--C--K--L--H--T--F--L--F--E--A--C--S--Y--A--T--L--L--H--V--L--T--L--S--F--E--R--
ACGTCCAGCTACACCCTGTCCTGCAAGCTGCACACTTTCCTCTTCGAGGCCTGCAGCTACGCTACGCTGCTGCACGTGCTGACACTCAGCTTTGAGCGCT
:::.::::::::::: :.:::::.::::: ::: ::::::::::::::.::::::::::::::::::::::::::::::::::.::::::::.:::::::
ACGCCCAGCTACACCGTATCCTGTAAGCTTCACTCTTTCCTCTTCGAGACCTGCAGCTACGCTACGCTGCTGCACGTGCTGACGCTCAGCTTCGAGCGCT
-T--P--S--Y--T--V--S--C--K--L--H--S--F--L--F--E--T--C--S--Y--A--T--L--L--H--V--L--T--L--S--F--E--R--

----------------------------------------------------------------------------------------------------
Y--I--A--I--C--H--P--F--R--Y--K--A--V--S--G--P--C--Q--V--K--L--L--I--G--F--V--W--V--T--S--A--L--V--A
ACATCGCCATCTGTCACCCCTTCAGGTACAAGGCTGTGTCGGGACCTTGCCAGGTGAAGCTGCTGATTGGCTTCGTCTGGGTCACCTCCGCCCTGGTGGC
:::::::::::::.::::::::::::::.:::::..:::: ::.::.::::::::::::::::::::::::::.::::::::::::::::::::::::::
ACATCGCCATCTGCCACCCCTTCAGGTATAAGGCCATGTCTGGGCCCTGCCAGGTGAAGCTGCTGATTGGCTTTGTCTGGGTCACCTCCGCCCTGGTGGC
Y--I--A--I--C--H--P--F--R--Y--K--A--M--S--G--P--C--Q--V--K--L--L--I--G--F--V--W--V--T--S--A--L--V--A

----------------------------------------------------------------------------------------------------
--L--P--L--L--F--A--M--G--T--E--Y--P--L--V--N--V--P--S--H--R--G--L--T--C--N--R--S--S--T--R--H--H--E-
ACTGCCCTTGCTGTTTGCCATGGGTACTGAGTACCCCCTGGTGAACGTGCCCAGCCACCGGGGTCTCACTTGCAACCGCTCCAGCACCCGCCACCACGAG
 .::::.::::: ::::::::::: ..:::.::::::.:::::.::::::::::.:::::::: ::: :::::::::::::. ::: ::.::::. ::::
CTTGCCTTTGCTTTTTGCCATGGGAGTTGAATACCCCTTGGTGGACGTGCCCAGTCACCGGGGGCTCTCTTGCAACCGCTCTCGCAACCACCACTCCGAG
--L--P--L--L--F--A--M--G--V--E--Y--P--L--V--D--V--P--S--H--R--G--L--S--C--N--R--S--R--N--H--H--S--E-

----------------------------------------------------------------------------------------------------
-Q--P--E--T--S--N--M--S--I--C--T--N--L--S--S--R--W--T--V--F--Q--S--S--I--F--G--A--F--V--V--Y--L--V--
CAGCCCGAGACCTCCAATATGTCCATCTGTACCAACCTCTCCAGCCGCTGGACCGTGTTCCAGTCCAGCATCTTCGGCGCCTTCGTGGTCTACCTCGTGG
:: :: :::::::::::.::::::.::::.:::::::::::.:::::.:::::.:::::::::::.::::::::.::.::::::.: .:::::.: ::::
CACCCGGAGACCTCCAACATGTCCGTCTGCACCAACCTCTCTAGCCGTTGGACTGTGTTCCAGTCTAGCATCTTTGGTGCCTTCATCATCTACTTGGTGG
-H--P--E--T--S--N--M--S--V--C--T--N--L--S--S--R--W--T--V--F--Q--S--S--I--F--G--A--F--I--I--Y--L--V--

----------------------------------------------------------------------------------------------------
V--L--L--S--V--A--F--M--C--W--N--M--M--Q--V--L--M--K--S--Q--K--G--S--L--A--G--G--T--R--P--P--Q--L--R
TCCTGCTCTCCGTAGCCTTCATGTGCTGGAACATGATGCAGGTGCTCATGAAAAGCCAGAAGGGCTCGCTGGCCGGGGGCACGCGGCCTCCGCAGCTGAG
::::: :::::::.::::::::::::::::.:::::::::::.::::  ::..::: :: ::::: :::::::::  .. . ::.::  :.:::::::::
TCCTGGTCTCCGTGGCCTTCATGTGCTGGAGCATGATGCAGGCGCTCCAGAGGAGCAAGCAGGGCACGCTGGCCGCCAAAGGGCAGCAGCTGCAGCTGAG
V--L--V--S--V--A--F--M--C--W--S--M--M--Q--A--L--Q--R--S--K--Q--G--T--L--A--A--K--G--Q--Q--L--Q--L--R

-------------------------------------------------------><-------------------------------------------
--K--S--E--S--E--E--S--R--T--A--R--R--Q--T--I--I--F--L--R--L--I--V--V--T--L--A--V--C--W--M--P--N--Q-
GAAGTCCGAGAGCGAAGAGAGCAGGACCGCCAGGAGGCAGACCATCATCTTCCTGAGGCTGATTGTTGTGACATTGGCCGTATGCTGGATGCCCAACCAG
:::::::::.:::::.:::::::::: :::: :.:::::::::::::::::::::   :::::.:::::::: .:::::.: :::::::::::.::::::
GAAGTCCGAAAGCGAGGAGAGCAGGAGCGCCCGAAGGCAGACCATCATCTTCCTG---CTGATCGTTGTGACCCTGGCCATCTGCTGGATGCCTAACCAG
--K--S--E--S--E--E--S--R--S--A--R--R--Q--T--I--I--F--L-----L--I--V--V--T--L--A--I--C--W--M--P--N--Q-

----------------------------------------------------------------------------------------------------
-I--R--R--I--M--A--A--A--K--P--K--H--D--W--T--R--S--Y--F--R--A--Y--M--I--L--L--P--F--S--E--T--F--F--
ATTCGGAGGATCATGGCTGCGGCCAAACCCAAGCACGACTGGACGAGGTCCTACTTCCGGGCGTACATGATCCTCCTCCCCTTCTCGGAGACGTTTTTCT
::::::::::: ::::::::::::::::::::::: :::::::: :.: ::::.::: .:::.:::::::::::::::::::::::::: :: ::.::::
ATTCGGAGGATGATGGCTGCGGCCAAACCCAAGCAGGACTGGACCAAGGCCTATTTCAAGGCATACATGATCCTCCTCCCCTTCTCGGACACTTTCTTCT
-I--R--R--M--M--A--A--A--K--P--K--Q--D--W--T--K--A--Y--F--K--A--Y--M--I--L--L--P--F--S--D--T--F--F--

----------------------------------------------------------------------------------------------------
Y--L--S--S--V--I--N--P--L--L--Y--T--V--S--S--Q--Q--F--R--R--V--F--V--Q--V--L--C--C--R--L--S--L--Q--H
ACCTCAGCTCGGTCATCAACCCGCTCCTGTACACGGTGTCCTCGCAGCAGTTTCGGCGGGTGTTCGTGCAGGTGCTGTGCTGCCGCCTGTCGCTGCAGCA
:::: ::::: :: .:::::::::: :::::::  :::::::::::::::::.::  : :::::.:.:::::: :::.::::::::::: :::::: :::
ACCTGAGCTCCGTGGTCAACCCGCTGCTGTACAACGTGTCCTCGCAGCAGTTCCGCAGTGTGTTTGCGCAGGTCCTGCGCTGCCGCCTGACGCTGCCGCA
Y--L--S--S--V--V--N--P--L--L--Y--N--V--S--S--Q--Q--F--R--S--V--F--A--Q--V--L--R--C--R--L--T--L--P--H

----------------------------------------------------------------------------------------------------
--A--N--H--E--K--R--L--R--V--H--A--H--S--T--T--D--S--A--R--F--V--Q--R--P--L--L--F-----A--S--R--R--Q-
CGCCAACCACGAGAAGCGCCTGCGCGTACATGCGCACTCCACCACCGACAGCGCCCGCTTTGTGCAGCGCCCGTTGCTCTTC---GCGTCCCGGCGCCAG
::::::.:: :: :::::::::::::. :: :::  ::::::::. :::::.:::::::. ::::: ::::::.:  :::::   :: ::: :: :: : 
CGCCAATCAGGATAAGCGCCTGCGCGCCCAGGCGGCCTCCACCATGGACAGTGCCCGCTCGGTGCACCGCCCGCTCATCTTCCTGGCTTCCAGGAGCAAT
--A--N--Q--D--K--R--L--R--A--Q--A--A--S--T--M--D--S--A--R--S--V--H--R--P--L--I--F--L--A--S--R--S--N-

----------------------------------------------------------------------------------------------------
-S--S--A--R--R--T--E--K--I--F--L--S--T--F--Q--S--E--A--E--P--Q--S--K--S--Q--S--L--S--L--E--S--L--E--
TCCTCTGCAAGGAGAACTGAGAAGATTTTCTTAAGCACTTTTCAGAGCGAGGCCGAGCCCCAGTCTAAGTCCCAGTCATTGAGTCTCGAGTCACTAGAGC
:::::::::                                                                                           
TCCTCTGCA-------------------------------------------------------------------------------------------
-S--S--A--------------------------------------------------------------------------------------------

---------------------------------------------------------------->
P--N--S--G--A--K--P--A--N--S--A--A--E--N--G--F--Q--E--H--E--V--*-
CCAACTCAGGCGCGAAACCAGCCAATTCTGCTGCAGAGAATGGTTTTCAGGAGCATGAAGTTTGA
                                                                 
-----------------------------------------------------------------
-----------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000876300
ATGGCTTCACCCAGCCGCCCCGGCAATGACTGCTCCCATGTTATTGATCACAGCCATGTTCCTGAATTCGAGGTAGCTACCTGGATCAAAATCACACTCA
TCCTACTGTTCCTGGTCATCTTTGTGGTGGGCATCCTGGGGAATAGTGTCACGATTCGGGTCACCCAGGTGCTGCAGAAGAAAGGCTACCTGCAGAAGGA
GGTGACAGACCACATGGTGAGCCTGGCTTGCTCCGACATCCTGGTCTTCCTCATTGGTATGCCCGTGGAGTTCTACAGCATCATCTGGAACCCCCTGACC
ACGCCCAGCTACACCGTATCCTGTAAGCTTCACTCTTTCCTCTTCGAGACCTGCAGCTACGCTACGCTGCTGCACGTGCTGACGCTCAGCTTCGAGCGCT
ACATCGCCATCTGCCACCCCTTCAGGTATAAGGCCATGTCTGGGCCCTGCCAGGTGAAGCTGCTGATTGGCTTTGTCTGGGTCACCTCCGCCCTGGTGGC
CTTGCCTTTGCTTTTTGCCATGGGAGTTGAATACCCCTTGGTGGACGTGCCCAGTCACCGGGGGCTCTCTTGCAACCGCTCTCGCAACCACCACTCCGAG
CACCCGGAGACCTCCAACATGTCCGTCTGCACCAACCTCTCTAGCCGTTGGACTGTGTTCCAGTCTAGCATCTTTGGTGCCTTCATCATCTACTTGGTGG
TCCTGGTCTCCGTGGCCTTCATGTGCTGGAGCATGATGCAGGCGCTCCAGAGGAGCAAGCAGGGCACGCTGGCCGCCAAAGGGCAGCAGCTGCAGCTGAG
GAAGTCCGAAAGCGAGGAGAGCAGGAGCGCCCGAAGGCAGACCATCATCTTCCTG---CTGATCGTTGTGACCCTGGCCATCTGCTGGATGCCTAACCAG
ATTCGGAGGATGATGGCTGCGGCCAAACCCAAGCAGGACTGGACCAAGGCCTATTTCAAGGCATACATGATCCTCCTCCCCTTCTCGGACACTTTCTTCT
ACCTGAGCTCCGTGGTCAACCCGCTGCTGTACAACGTGTCCTCGCAGCAGTTCCGCAGTGTGTTTGCGCAGGTCCTGCGCTGCCGCCTGACGCTGCCGCA
CGCCAATCAGGATAAGCGCCTGCGCGCCCAGGCGGCCTCCACCATGGACAGTGCCCGCTCGGTGCACCGCCCGCTCATCTTCCTGGCTTCCAGGAGCAAT
TCCTCT----------------------------------------------------------------------------------------------
--------------------------------------------------------------


>BGISUSP0000876300
MASPSRPGNDCSHVIDHSHVPEFEVATWIKITLILLFLVIFVVGILGNSVTIRVTQVLQKKGYLQKEVTDHMVSLACSDILVFLIGMPVEFYSIIWNPLT
TPSYTVSCKLHSFLFETCSYATLLHVLTLSFERYIAICHPFRYKAMSGPCQVKLLIGFVWVTSALVALPLLFAMGVEYPLVDVPSHRGLSCNRSRNHHSE
HPETSNMSVCTNLSSRWTVFQSSIFGAFIIYLVVLVSVAFMCWSMMQALQRSKQGTLAAKGQQLQLRKSESEESRSARRQTIIFL-LIVVTLAICWMPNQ
IRRMMAAAKPKQDWTKAYFKAYMILLPFSDTFFYLSSVVNPLLYNVSSQQFRSVFAQVLRCRLTLPHANQDKRLRAQAASTMDSARSVHRPLIFLASRSN
SS----------------------------------------------------