Sequences
EST Library Info
ecc1Foetus 50 days, cortex cerebri
fat3Fatt
nbm1Newborn 115 days, bone marrow (pelvis)
nje1Newborn 115 days, jejunum
Clusters
Oligos
SNPs

Gene ID ENSG00000146067 (click for geneview)
Transcript ID ENST00000329540(link to ensembl)
Symbol NP_061930.1
Localtion Chromosome:5:176879397:176914114:-1 band: 5q35.3
Description hypothetical protein FLJ10404
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-Q--P--A--E--G--Q--A--V--S--T--D--G--A--R--K--E--A--Q--I--R--G--H--A--G--S--G--Q--G--E--E--A--V--Q--
CAGCCAGCCGAGGGACAGGCCGTGAGCACAGACGGCGCCAGGAAGGAGGCTCAGATCAGAGGGCATGCTGGCTCTGGCCAGGGGGAGGAAGCAGTGCAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------><----------------------------------------------------------------------------------------
K--S--H--K--P--P--A--A--P--T--S--R--N--Y--T--E--I--R--E--K--L--R--S--R--L--T--R--R--K--E--E--L--P--M
AGTCTCATAAGCCACCCGCTGCCCCGACGAGTCGGAACTATACCGAGATCCGGGAGAAGCTCCGCTCGAGGCTGACCAGGCGGAAAGAGGAGCTGCCCAT
           ::::::::::::::::::::::::::.::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::
-----------CCACCCGCTGCCCCGACGAGTCGGAATTATACCGAGATCCGAGAGAAGCTCCGCTCGAGGCTGACCAGGCGGAAAGAGGAGCTGCCCAT
------------P--P--A--A--P--T--S--R--N--Y--T--E--I--R--E--K--L--R--S--R--L--T--R--R--K--E--E--L--P--M

----------------------------------------------------------------------------------------------------
--K--G--G--T--L--G--G--I--P--G--E--P--A--V--D--H--R--D--V--D--E--L--L--E--F--I--N--S--T--E--P--K--V-
GAAGGGGGGCACCCTGGGCGGGATCCCTGGGGAGCCCGCCGTGGACCACCGAGATGTGGATGAGCTGCTGGAATTCATCAACAGCACGGAGCCCAAAGTC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GAAGGGGGGCACCCTGGGCGGGATCCCTGGGGAGCCCGCCGTGGACCACCGAGATGTGGATGAGCTGCTGGAATTCATCAACAGCACGGAGCCCAAAGTC
--K--G--G--T--L--G--G--I--P--G--E--P--A--V--D--H--R--D--V--D--E--L--L--E--F--I--N--S--T--E--P--K--V-

--------------------------------------------------><------------------------------------------------
-P--N--S--A--R--A--A--K--R--A--R--H--K--L--K--K--K--E--K--E--K--A--Q--L--A--A--E--A--L--K--Q--A--N--
CCCAACAGCGCCAGGGCCGCCAAGCGGGCCCGGCACAAGCTGAAAAAGAAGGAAAAGGAGAAGGCCCAGTTGGCAGCAGAAGCTCTAAAGCAGGCAAATC
:::::::::::::::::::::::::::::::::::::::::::::::::::                                                 
CCCAACAGCGCCAGGGCCGCCAAGCGGGCCCGGCACAAGCTGAAAAAGAAG-------------------------------------------------
-P--N--S--A--R--A--A--K--R--A--R--H--K--L--K--K--K--------------------------------------------------

----------------------------------------------------------------------------------------------------
R--V--S--G--S--R--E--P--R--P--A--R--E--R--L--L--E--W--P--D--R--E--L--D--R--V--N--S--F--L--S--S--R--L
GTGTTTCTGGAAGCCGGGAGCCAAGGCCTGCCAGGGAGAGGCTCTTGGAGTGGCCCGACCGGGAACTGGATCGGGTCAACAGCTTCCTGAGCAGCCGTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--E--I--K--N--T--V--K--D--S--I--R--A--S--F--S--V--C--E--L--S--M--D--S--N--G--F--S--K--E--G--A--A-
GCAGGAGATCAAAAACACTGTCAAAGACTCCATCCGTGCCAGCTTCAGTGTGTGTGAGCTCAGCATGGACAGCAATGGCTTCTCTAAGGAGGGGGCTGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--P--E--P--Q--S--L--P--P--S--N--L--S--G--S--S--E--Q--Q--P--D--I--N--L--D--L--S--P--L--T--L--G--S--
GAGCCTGAGCCTCAGAGTCTACCCCCCTCAAACCTCAGTGGCTCCTCAGAGCAGCAGCCTGACATCAACCTTGACCTGTCCCCTTTGACTTTGGGCTCCC
            ::::::::: :::::::::::::::.:::::::::::::::.:.::::::::::::::::::.:::::::::::::::::::::::::
------------CAGAGTCTAACCCCCTCAAACCTCAATGGCTCCTCAGAGCAACGGCCTGACATCAACCTTGATCTGTCCCCTTTGACTTTGGGCTCCC
-------------Q--S--L--T--P--S--N--L--N--G--S--S--E--Q--R--P--D--I--N--L--D--L--S--P--L--T--L--G--S--

----------------------------------------------------------------------------------------------------
P--Q--N--H--T--L--Q--A--P--G--E--P--A--P--P--W--A--E--M--R--G--P--H--P--P--W--T--E--V--R--G--P--P--P
CTCAGAACCACACGTTACAAGCTCCAGGCGAGCCAGCCCCACCATGGGCAGAAATGAGAGGCCCCCACCCACCATGGACAGAGGTGAGGGGGCCCCCTCC
::::::::::.:..:::::::::::::::::::::::::::::::::::::::::::::.:.::::::::::::::::::::::::::::: ::::::::
CTCAGAACCATATATTACAAGCTCCAGGCGAGCCAGCCCCACCATGGGCAGAAATGAGAAGTCCCCACCCACCATGGACAGAGGTGAGGGGCCCCCCTCC
P--Q--N--H--I--L--Q--A--P--G--E--P--A--P--P--W--A--E--M--R--S--P--H--P--P--W--T--E--V--R--G--P--P--P

----------------------------------------------------------------------------------------------------
--G--I--V--P--E--N--G--L--V--R--R--L--N--T--V--P--N--L--S--R--V--I--W--V--K--T--P--K--P--G--Y--P--S-
CGGTATCGTCCCCGAGAACGGGCTCGTGAGGAGACTCAACACCGTGCCCAACCTATCCCGGGTGATCTGGGTCAAGACACCCAAGCCGGGCTACCCCAGC
:::::::.::::::::::.::::: :::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::.::: ::::.:::
CGGTATCATCCCCGAGAATGGGCTAGTGAGGAGACTCAACACCGTGCCCAACCTGTCCCGGGTGATCTGGGTCAAGACACCCAAGCCAGGCAACCCTAGC
--G--I--I--P--E--N--G--L--V--R--R--L--N--T--V--P--N--L--S--R--V--I--W--V--K--T--P--K--P--G--N--P--S-

----------------------------------------------------------------------------------------------------
-S--E--E--P--S--S--K--E--V--P--S--C--K--Q--E--L--P--E--P--V--S--S--G--G--K--P--Q--K--G--K--R--Q--G--
TCCGAGGAGCCAAGCTCAAAGGAAGTTCCCAGTTGCAAGCAGGAGCTGCCTGAGCCTGTGTCCTCAGGTGGGAAGCCACAGAAGGGCAAGAGGCAGGGCA
::.::::::::::::.:: ::::.::.:::.:.::::::::::::.::::::::::: :: ::::::::::::::::.:.::::::::::::.:::::::
TCTGAGGAGCCAAGCCCACAGGAGGTCCCCGGCTGCAAGCAGGAGTTGCCTGAGCCTTTGGCCTCAGGTGGGAAGCCGCGGAAGGGCAAGAGACAGGGCA
-S--E--E--P--S--P--Q--E--V--P--G--C--K--Q--E--L--P--E--P--L--A--S--G--G--K--P--R--K--G--K--R--Q--G--

----------------------------------------------------------------------------------------------------
S--Q--A--K--K--S--E--A--S--P--A--P--R--P--P--A--S--L--E--V--P--S--A--K--G--Q--V--A--G--P--K--Q--P--G
GTCAGGCCAAGAAGAGCGAGGCAAGCCCAGCCCCCCGGCCCCCAGCCAGCCTAGAGGTTCCCAGTGCCAAGGGCCAGGTCGCTGGCCCCAAGCAGCCAGG
:::::::::::::::::::::..:::::: ::::::.:.:::::::: :::: ::::.:::::::::::::::::::..: :..::::::::::::::::
GTCAGGCCAAGAAGAGCGAGGTGAGCCCACCCCCCCAGTCCCCAGCCTGCCTTGAGGCTCCCAGTGCCAAGGGCCAGACCCCCAGCCCCAAGCAGCCAGG
S--Q--A--K--K--S--E--V--S--P--P--P--Q--S--P--A--C--L--E--A--P--S--A--K--G--Q--T--P--S--P--K--Q--P--G

----------------------------------------------------------------------------------------------------
--R--V--L--E--L--P--K--V--G--S--C--A--E--A--G--E--G--S--R--G--S--R--P--G--P--G--W--A--G--S--P--K--T-
CAGGGTCCTAGAGCTTCCCAAAGTAGGCAGCTGTGCTGAGGCTGGAGAGGGGAGCCGGGGGAGCCGGCCAGGACCAGGTTGGGCTGGCAGTCCCAAAACT
::.::.:::.::::.:::::.:::.:.:::::::::.::::::::::::::::::::::::. ::..:::::::::::.:::::::::::.::::::.::
CAAGGCCCTGGAGCCTCCCAGAGTGGACAGCTGTGCCGAGGCTGGAGAGGGGAGCCGGGGGGCCCAACCAGGACCAGGCTGGGCTGGCAGCCCCAAAGCT
--K--A--L--E--P--P--R--V--D--S--C--A--E--A--G--E--G--S--R--G--A--Q--P--G--P--G--W--A--G--S--P--K--A-

----------------------------------------------------------------------------------------------------
-E--K--E--K--G--S--S--W--R--N--W--P--G--E--A--K--A--R--P--Q--E--Q--E--S--V--Q--P--S--G--P--A--R--P--
GAGAAGGAGAAGGGCAGCTCCTGGCGAAACTGGCCAGGCGAGGCCAAGGCACGGCCTCAGGAGCAGGAGTCTGTGCAGCCCTCAGGCCCAGCAAGGCCAC
:: :::::::::::::::::::::::::::::::::::.:::.: ::::.:::::::: ::::::::::::::::::::::.::::::::::::::::::
GACAAGGAGAAGGGCAGCTCCTGGCGAAACTGGCCAGGTGAGACAAAGGTACGGCCTCTGGAGCAGGAGTCTGTGCAGCCCCCAGGCCCAGCAAGGCCAC
-D--K--E--K--G--S--S--W--R--N--W--P--G--E--T--K--V--R--P--L--E--Q--E--S--V--Q--P--P--G--P--A--R--P--

-----------------------------------------------------------------------><---------------------------
Q--S--L--P--Q--G--K--G--R--S--R--R--S--R--N--K--Q--E--K--P--A--S--S--L--D--D--V--F--L--P--K--D--M--D
AGAGCTTGCCCCAGGGCAAGGGCCGCAGCCGCCGGAGCCGCAACAAGCAGGAGAAGCCAGCCTCCTCCTTGGACGATGTGTTCCTGCCCAAGGACATGGA
:::::::::: :::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::   ::::::::::::::.:::::::::::
AGAGCTTGCCACAGGGCAAGGGCCGCAGCCGCCGGAGCCGCAACAAGCAGGAGAAGTCAGCCTCCTCCTTG---GATGTGTTCCTGCCTAAGGACATGGA
Q--S--L--P--Q--G--K--G--R--S--R--R--S--R--N--K--Q--E--K--S--A--S--S--L-----D--V--F--L--P--K--D--M--D

-----------------------------------------------><---------------------------------------------------
--G--V--E--M--D--E--T--D--R--E--V--E--Y--F--K--R--F--C--L--D--S--A--K--Q--T--R--Q--K--V--A--V--N--W-
CGGGGTGGAGATGGATGAGACTGACCGAGAGGTGGAGTACTTTAAGAGGTTCTGTTTGGATTCTGCAAAGCAGACTCGTCAGAAAGTTGCTGTGAACTGG
:::::.:::::::::::::::::::::.::::::::::::::.:::   :::::::::::::::::::::::.:: ::::::::::::::.:::::::::
CGGGGCGGAGATGGATGAGACTGACCGGGAGGTGGAGTACTTCAAG---TTCTGTTTGGATTCTGCAAAGCAAACACGTCAGAAAGTTGCCGTGAACTGG
--G--A--E--M--D--E--T--D--R--E--V--E--Y--F--K-----F--C--L--D--S--A--K--Q--T--R--Q--K--V--A--V--N--W-

-------------------------------------------->
-T--N--F--S--L--K--K--T--T--P--S--T--A--Q--*-
ACCAACTTCAGCCTCAAGAAAACCACTCCTAGCACAGCTCAGTGA
:::::::::::::::::::::::::::::.:::::::::::::::
ACCAACTTCAGCCTCAAGAAAACCACTCCCAGCACAGCTCAGTGA
-T--N--F--S--L--K--K--T--T--P--S--T--A--Q--*-

Pig Consensus Sequence

>BGISUST0000878537
----------------------------------------------------------------------------------------------------
-----------CCACCCGCTGCCCCGACGAGTCGGAATTATACCGAGATCCGAGAGAAGCTCCGCTCGAGGCTGACCAGGCGGAAAGAGGAGCTGCCCAT
GAAGGGGGGCACCCTGGGCGGGATCCCTGGGGAGCCCGCCGTGGACCACCGAGATGTGGATGAGCTGCTGGAATTCATCAACAGCACGGAGCCCAAAGTC
CCCAACAGCGCCAGGGCCGCCAAGCGGGCCCGGCACAAGCTGAAAAAGAAG-------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------CAGAGTCTAACCCCCTCAAACCTCAATGGCTCCTCAGAGCAACGGCCTGACATCAACCTTGATCTGTCCCCTTTGACTTTGGGCTCCC
CTCAGAACCATATATTACAAGCTCCAGGCGAGCCAGCCCCACCATGGGCAGAAATGAGAAGTCCCCACCCACCATGGACAGAGGTGAGGGGCCCCCCTCC
CGGTATCATCCCCGAGAATGGGCTAGTGAGGAGACTCAACACCGTGCCCAACCTGTCCCGGGTGATCTGGGTCAAGACACCCAAGCCAGGCAACCCTAGC
TCTGAGGAGCCAAGCCCACAGGAGGTCCCCGGCTGCAAGCAGGAGTTGCCTGAGCCTTTGGCCTCAGGTGGGAAGCCGCGGAAGGGCENST000003554
77


>BGISUSP0000878537
-------------------------------------PPAAPTSRNYTEIREKLRSRLTRRKEELPMKGGTLGGIPGEPAVDHRDVDELLEFINSTEPKV
PNSARAAKRARHKLKKK-----------------------------------------------------------------------------------
----QSLTPSNLNGSSEQRPDINLDLSPLTLGSPQNHILQAPGEPAPPWAEMRSPHPPWTEVRGPPPGIIPENGLVRRLNTVPNLSRVIWVKTPKPGNPS
SEEPSPQEVPGCKQELPEPLASGGKPRKG-----