Sequences
EST Library Info
jej1Small intestine, jejunum
nco1Newborn 115 days, colon
Clusters
Oligos
SNPs

Gene ID ENSG00000185156 (click for geneview)
Transcript ID ENST00000329805(link to ensembl)
Symbol NP_689812.2
Localtion Chromosome:17:8641403:8643163:-1 band: 17p13.1
Description hypothetical protein FLJ35773
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--A--N--P--R--W--D--I--S--R--A--L--G--V--A--K--L--F--H--L--V--C--G--V--R--E--A--C--V--T--P--F--
ATGAGTGCCAACCCCCGGTGGGACATCAGCAGGGCGCTGGGGGTGGCCAAGCTCTTCCACCTGGTGTGCGGGGTGCGGGAAGCCTGCGTGACCCCGTTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--T--L--Y--L--R--Q--L--G--L--A--A--P--W--V--G--T--L--M--G--T--K--H--L--I--A--A--F--W--A--P--V--C--A
TGACCCTTTACCTGAGGCAGCTGGGCTTGGCCGCGCCCTGGGTGGGCACCCTAATGGGAACCAAGCACCTAATCGCTGCCTTCTGGGCTCCCGTCTGTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--F--L--A--K--S--Y--R--K--R--R--A--L--L--I--G--S--L--L--G--S--V--G--A--S--L--L--M--V--L--V--P--P--V-
CTTCCTGGCCAAAAGCTACCGGAAAAGGAGAGCGCTTCTGATCGGCTCCCTGCTCGGCTCGGTGGGGGCCAGCCTGCTGATGGTCCTGGTCCCACCGGTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--K--N--R--V--H--F--P--C--N--G--S--S--G--L--T--S--T--D--A--L--P--G--V--T--L--P--V--N--I--T--S--A--
GACAAAAATCGGGTGCACTTCCCTTGTAATGGAAGCAGCGGCCTGACCAGCACAGACGCACTCCCGGGGGTCACGCTACCTGTGAACATCACCTCGGCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Q--E--S--A--S--S--H--P--A--K--R--T--A--E--V--E--M--P--G--F--R--N--P--P--G--E--S--D--R--E--T--F--R--D
AAGAGTCTGCCTCCAGCCACCCAGCCAAGAGGACTGCAGAGGTGGAAATGCCTGGCTTCAGAAACCCACCTGGTGAAAGTGACCGAGAAACTTTCCGTGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--H--V--Y--L--A--P--S--V--E--G--A--R--T--T--S--Q--A--L--L--H--P--V--T--S--G--L--K--D--H--P--W--E-
TCTGCACGTCTACTTAGCGCCCTCCGTTGAAGGAGCTAGGACCACATCCCAAGCTCTCCTCCATCCTGTCACTTCGGGGCTGAAAGATCATCCCTGGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--T--F--E--V--V--K--T--A--L--P--L--L--P--G--G--K--G--P--G--N--P--A--N--L--S--G--T--K--G--K--A--W--
GTTACTTTTGAGGTGGTCAAGACAGCCCTCCCCTTGCTTCCTGGGGGGAAAGGGCCCGGGAATCCAGCCAATTTGTCAGGGACCAAGGGGAAAGCCTGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--F--D--L--S--L--E--A--L--R--R--T--F--I--L--S--L--G--S--V--A--F--W--E--L--L--T--A--P--L--E--Q--V--A
CTTTTGACCTGTCCTTGGAGGCGTTGCGGCGGACTTTTATCCTCTCCTTGGGGTCCGTGGCGTTCTGGGAGCTGCTGACAGCGCCTCTGGAGCAGGTGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--D--D--S--L--Y--E--F--L--D--F--V--D--A--T--D--R--Y--R--S--L--W--V--W--R--L--L--G--M--S--A--G--V--C-
AGATGACAGCCTTTATGAGTTCCTGGATTTTGTGGATGCCACTGACCGATACAGAAGCCTGTGGGTCTGGAGGTTGCTGGGCATGTCGGCAGGCGTGTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--I--T--A--L--V--G--Q--L--D--C--F--L--M--T--S--G--P--R--G--V--V--H--F--Y--G--Y--S--V--V--S--T--L--
GGCATCACAGCCTTGGTGGGGCAGCTGGACTGCTTCCTGATGACCAGTGGCCCCCGAGGTGTGGTCCACTTCTATGGGTACTCGGTGGTCAGCACCCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--L--L--V--S--I--A--F--P--I--P--I--C--Q--Q--W--E--P--S--Y--K--R--V--K--A--L--S--I--V--G--G--D--P--H
CCTTACTGGTGAGCATTGCCTTTCCCATTCCCATCTGTCAGCAGTGGGAGCCCAGCTACAAAAGGGTCAAAGCACTGTCCATTGTGGGGGGTGACCCCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--I--L--L--A--S--T--T--V--L--V--G--A--I--V--S--T--V--Q--N--F--L--F--W--H--M--K--D--H--G--S--G--E-
CCTCATTCTCCTCGCCTCCACCACTGTTTTGGTAGGAGCCATCGTCAGTACTGTCCAGAACTTTCTGTTCTGGCACATGAAGGACCATGGGAGCGGCGAG
                                                                                        ::::::.:::::
----------------------------------------------------------------------------------------GGGAGCAGCGAG
-----------------------------------------------------------------------------------------G--S--S--E-

----------------------------------------------------------------------------------------------------
-L--V--M--G--F--S--V--A--L--S--L--L--G--E--I--L--L--H--P--F--K--A--T--L--L--R--K--L--S--R--T--G--L--
CTGGTCATGGGTTTCTCGGTCGCCCTCAGCTTGCTGGGGGAAATTCTGCTTCATCCGTTCAAAGCTACATTGCTTAGGAAACTGTCCAGGACGGGCCTGG
:::::::::::.:::::::: ::::: .::::::::::::::::::::::.::::: ::::::.:: :..::::.:::::.:::::::.:..:::: ..:
CTGGTCATGGGCTTCTCGGTGGCCCTGGGCTTGCTGGGGGAAATTCTGCTCCATCCTTTCAAAACTCCGCTGCTCAGGAAGCTGTCCAAGGTGGGCACAG
-L--V--M--G--F--S--V--A--L--G--L--L--G--E--I--L--L--H--P--F--K--T--P--L--L--R--K--L--S--K--V--G--T--

----------------------------------------------------------------------------------------------------
V--G--L--G--L--S--C--L--A--G--Q--L--L--Y--Y--S--F--L--W--S--W--W--S--V--L--P--I--Q--I--L--S--A--I--S
TGGGGCTGGGGCTGAGCTGCCTCGCTGGGCAGCTGCTGTACTACTCTTTCCTCTGGAGCTGGTGGTCCGTCCTCCCCATTCAGATCTTGAGTGCCATTAG
:::::.::::::::.::::::: :: ::::::::::::::.::::: ::::::::::::::::::::.::.::::::.:::::::::: ::.:::::.::
TGGGGTTGGGGCTGGGCTGCCTGGCGGGGCAGCTGCTGTATTACTCGTTCCTCTGGAGCTGGTGGTCTGTTCTCCCCGTTCAGATCTTCAGCGCCATCAG
V--G--L--G--L--G--C--L--A--G--Q--L--L--Y--Y--S--F--L--W--S--W--W--S--V--L--P--V--Q--I--F--S--A--I--S

----------------------------------------------------------------------------------------------------
--N--R--A--L--W--W--A--V--G--A--S--V--E--D--L--A--T--P--R--M--E--R--A--L--S--A--L--F--R--G--H--F--Y-
CAACAGAGCTTTGTGGTGGGCTGTGGGGGCCTCAGTAGAGGACCTGGCCACTCCCCGCATGGAGAGGGCTCTGAGTGCCTTGTTCCGAGGCCACTTTTAC
: ::.:.:::.:::::::::: :: :::::::: .:::::::::::::::::::  :::.::::::. : ::  .:::: ::::::::::::::::::::
CCACGGGGCTCTGTGGTGGGCAGTCGGGGCCTCCATAGAGGACCTGGCCACTCCGGGCACGGAGAGACCGCTCCATGCCATGTTCCGAGGCCACTTTTAC
--H--G--A--L--W--W--A--V--G--A--S--I--E--D--L--A--T--P--G--T--E--R--P--L--H--A--M--F--R--G--H--F--Y-

----------------------------------------------------------------------------------------------------
-G--S--G--C--S--L--G--S--F--V--G--G--F--V--V--M--R--F--S--L--A--V--L--Y--Q--A--C--C--V--A--L--L--L--
GGGAGTGGCTGTAGCCTGGGCAGCTTTGTCGGGGGCTTCGTGGTGATGCGCTTCAGCCTGGCTGTGCTCTACCAGGCCTGCTGTGTGGCCCTGTTGCTCT
:::.:.::   .:::::::::::::::::::: :::::::::: ::::::::::.:::::::::: :::::::::::::::::.::::.::::: :::::
GGGGGCGGGGCCAGCCTGGGCAGCTTTGTCGGCGGCTTCGTGGGGATGCGCTTCGGCCTGGCTGTTCTCTACCAGGCCTGCTGCGTGGTCCTGTGGCTCT
-G--G--G--A--S--L--G--S--F--V--G--G--F--V--G--M--R--F--G--L--A--V--L--Y--Q--A--C--C--V--V--L--W--L--

----------------------------------------------------------------------------------------------------
W--L--A--L--L--L--S--I--Q--R--R--L--P--R--E--R--K--I--K--Y--S--K--L--L--S--M--E--V--S--D--T--S--D--S
GGTTGGCCTTGCTCCTGTCCATACAGCGGAGGCTGCCCCGAGAGCGGAAAATCAAGTACTCGAAGCTGCTGTCCATGGAGGTGAGTGACACCAGTGACTC
::.::::::::.:::::::::: :.::  ::.:::::::::::.:::::.::::: ::::: ::::::::: ::.::::::. :::::::: ::.:::::
GGCTGGCCTTGTTCCTGTCCATCCGGCCCAGACTGCCCCGAGAACGGAAGATCAACTACTCCAAGCTGCTGGCCGTGGAGGCCAGTGACACGAGCGACTC
W--L--A--L--F--L--S--I--R--P--R--L--P--R--E--R--K--I--N--Y--S--K--L--L--A--V--E--A--S--D--T--S--D--S

------------------------------------------------------------>
--E--Q--G--T--E--Q--D--W--L--V--K--A--M--R--E--E--H--S--D--*-
TGAGCAGGGGACAGAACAGGACTGGCTTGTGAAGGCCATGAGGGAGGAACACTCAGACTGA
:::::::::::: ::::.:::::::::::::::.::::::::::: :::: ::::::::::
TGAGCAGGGGACTGAACGGGACTGGCTTGTGAAAGCCATGAGGGACGAACCCTCAGACTGA
--E--Q--G--T--E--R--D--W--L--V--K--A--M--R--D--E--P--S--D--*-

Pig Consensus Sequence

>BGISUST0000879925
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------GGGAGCAGCGAG
CTGGTCATGGGCTTCTCGGTGGCCCTGGGCTTGCTGGGGGAAATTCTGCTCCATCCTTTCAAAACTCCGCTGCTCAGGAAGCTGTCCAAGGTGGGCACAG
TGGGGTTGGGGCTGGGCTGCCTGGCGGGGCAGCTGCTGTATTACTCGTTCCTCTGGAGCTGGTGGTCTGTTCTCCCCGTTCAGATCTTCAGCGCCATCAG
CCACGGGGCTCTGTGGTGGGCAGTCGGGGCCTCCATAGAGGACCTGGCCACTCCGGGCACGGAGAGACCGCTCCATGCCATGTTCCGAGGCCACTTTTAC
GGGGGCGGGGCCAGCCTGGGCAGCTTTGTCGGCGGCTTCGTGGGGATGCGCTTCGGCCTGGCTGTTCTCTACCAGGCCTGCTGCGTGGTCCTGTGGCTCT
GGCTGGCCTTGTTCCTGTCCATCCGGCCCAGACTGCCCCGAGAACGGAAGATCAACTACTCCAAGCTGCTGGCCGTGGAGGCCAGTGACACGAGCGACTC
TGAGCAGGGGACTGAACGGGACTGGCTTGTGAAAGCCATGAGGGACGAACCCTCAGACTGA


>BGISUSP0000879925
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------GSSE
LVMGFSVALGLLGEILLHPFKTPLLRKLSKVGTVGLGLGCLAGQLLYYSFLWSWWSVLPVQIFSAISHGALWWAVGASIEDLATPGTERPLHAMFRGHFY
GGGASLGSFVGGFVGMRFGLAVLYQACCVVLWLWLALFLSIRPRLPRERKINYSKLLAVEASDTSDSEQGTERDWLVKAMRDEPSD*