Sequences
EST Library Info
csk1Skin - RNA from China
ebs1Foetus 50 days, brain stem
fat1Fatt
jca1Joint capsule
lin2Large intestine
plun1Unavailable
tra1Trachea
uio1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000185459 (click for geneview)
Transcript ID ENST00000329833(link to ensembl)
Symbol Q9H388_HUMAN
Localtion Chromosome:7:135068764:135071186:1 band: 7q33
Description PRO2474.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--V--L--A--S--F--T--Q--N--M--N--I--K--C--C--E--F--V--C--Q--V--V--Q--K--Y--I--I--N--N--L--V--------
ATGGTTTTAGCTTCCTTTACTCAAAATATGAACATTAAGTGTTGTGAATTTGTCTGCCAAGTGGTTCAGAAATACATTATAAATAACCTAGTT------A
   :::::::::::: ::::::::::::::::::::::::::::::::: : ::::::::::::::::::::::::::::::::::::::::       :
---GTTTTAGCTTCCATTACTCAAAATATGAACATTAAGTGTTGTGAATGTCTCTGCCAAGTGGTTCAGAAATACATTATAAATAACCTAGT-TTAAAAA
----V--L--A--S--I--T--Q--N--M--N--I--K--C--C--E--C--L--C--Q--V--V--Q--K--Y--I--I--N--N--L--V--L--K--

----------------------------------------------------------------------------------------------------
K--K--R--N--C--E--P--S--W--S--V--Y--S--I--L--C--L--Y--V--I--F-----S--S--N--R--F--I--I--I--G--F--T--K
AAAAAAGAAACTGTGAACCATCTTGGTCAGTCTATTCTATTCTATGTTTATATGTTATTTTC---TCAAGCAATCGCTTCATAATTATAGGGTTTACAAA
::::::::::.:.:.::::::::::::::::::: :::          :.: :::::::::.   :::::::::::::::::.::::.::: ::::::::
AAAAAAGAAATTATAAACCATCTTGGTCAGTCTAGTCT---------ATGTTTGTTATTTTTC--TCAAGCAATCGCTTCATGATTACAGGTTTTACAAA
K--K--R--N--Y--K--P--S--W--S--V--*--S-----------M--F--V--I--F--\--S--S--N--R--F--M--I--T--G--F--T--K

----------------------------------------------------------------
--R--S--R--K--K--S--E--G--E--I--A--S--T--A--L--Q--A--T--S--G--*-
AAGGTCGAGAAAGAAAAGCGAAGGCGAAATAGCCTCTACTGCATTACAAGCAACATCAGGATAA
: ::..:::::::::.:.  : :::.::.:::::::::::::.:::                  
ATGGCTGAGAAAGAAGAAGCA-GGCAAAGTAGCCTCTACTGCGTTA------------------
--W--L--R--K--K--K--Q--G--K--V--A--S--T--A--L-------------------

Pig Consensus Sequence

>BGISUST0000894680
---GTTTTAGCTTCCATTACTCAAAATATGAACATTAAGTGTTGTGAATGTCTCTGCCAAGTGGTTCAGAAATACATTATAAATAACCTatTAAAAAAAA
AAAGAAATTATAAACCATCTTGGTCAGTCTAGTCTATGTTTGTttTTTTCTCAAGCAATCGCTTCATGATTACAGGTTTTACAAAATGGCTGAGAAAggA
AGCAGGCAAAGTAGCCTCTACT------------------


>BGISUSP0000894680
-VLASITQNMNIKCCECLCQVVQKYIINNLLKKKRNYKPSWSV*SMFVFFSSNRFMITGFTKWLRKEAGKVAST------