Sequences
EST Library Info
cad1Unavailable
cli2Liver - RNA from China
ecc1Foetus 50 days, cortex cerebri
eye1Foetus 50 days, Eye
fhi1Unavailable
hyp3Hypothalamus
jca1Joint capsule
med1Mediastinum
nbm1Newborn 115 days, bone marrow (pelvis)
nms1Newborn 115 days, M. semitendinosus
pgl2Pituitary gland
pigca3Unavailable
plac1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000183258 (click for geneview)
Transcript ID ENST00000330503(link to ensembl)
Symbol DDX41
Localtion Chromosome:5:176871185:176877076:-1 band: 5q35.3
Description DEAD-box protein abstrakt homolog (DEAD-box protein 41). [Source:Uniprot/SWISSPROT;Acc:Q9UJV9]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------><------------------------------------------------------------------------
-M--E--E--S--E--P--E--R--K--R--A--R--T--D--E--V--P--A--G--G--S--R--S--E--A--E--D--E--D--D--E--D--Y--
ATGGAGGAGTCGGAACCCGAACGGAAGCGGGCTCGCACCGACGAGGTGCCTGCCGGAGGAAGCCGCTCCGAGGCGGAAGATGAGGACGACGAGGACTACG
                           :::::::::::::::::::.. :::::. :::::::::::::::::::::.:::::::::::.:::::.::.:
---------------------------CGGGCTCGCACCGACGAGGCAACTGCCACAGGAAGCCGCTCCGAGGCGGAGGATGAGGACGATGAGGATTATG
----------------------------R--A--R--T--D--E--A--T--A--T--G--S--R--S--E--A--E--D--E--D--D--E--D--Y--

-------------------------------------><-------------------------------------------------------------
V--P--Y--V--P--L--R--Q--R--R--Q--L--L--L--Q--K--L--L--Q--R--R--R--K--G--A--A--E--E--E--Q--Q--D--S--G
TGCCCTATGTGCCGTTACGGCAGCGCCGGCAGCTACTGCTCCAGAAGCTGCTGCAGCGAAGACGCAAGGGAGCTGCGGAGGAAGAGCAGCAGGACAGCGG
:.:::::.::.::..:.::.::::::::::::.:.::::::::::::::::: ::::::::.:::::::::::::::::.::.:::::::::::::::::
TACCCTACGTACCACTGCGACAGCGCCGGCAGTTGCTGCTCCAGAAGCTGCTTCAGCGAAGGCGCAAGGGAGCTGCGGAAGAGGAGCAGCAGGACAGCGG
V--P--Y--V--P--L--R--Q--R--R--Q--L--L--L--Q--K--L--L--Q--R--R--R--K--G--A--A--E--E--E--Q--Q--D--S--G

-------------------------------------------------------------------------------------------------><-
--S--E--P--R--G--D--E--D--D--I--P--L--G--P--Q--S--N--V--S--L--L--D--Q--H--Q--H--L--K--E--K--A--E--A-
TAGTGAACCCCGGGGAGATGAGGACGACATCCCGCTAGGCCCTCAGTCCAACGTCAGCCTCCTGGATCAGCACCAGCACCTTAAAGAGAAGGCTGAAGCG
.::.::::::::.:::::::::::::::::::::::.:::::::::::::::::::::::.::::::::::::::::::::.::....:.:         
CAGCGAACCCCGAGGAGATGAGGACGACATCCCGCTGGGCCCTCAGTCCAACGTCAGCCTTCTGGATCAGCACCAGCACCTCAAGAGAAGG---------
--S--E--P--R--G--D--E--D--D--I--P--L--G--P--Q--S--N--V--S--L--L--D--Q--H--Q--H--L--K--R--R----------

------------------------------------------------------------------------><--------------------------
-R--K--E--S--A--K--E--K--Q--L--K--E--E--E--K--I--L--E--S--V--A--E--G--R--A--L--M--S--V--K--E--M--A--
CGCAAAGAGTCTGCCAAGGAGAAGCAGCTGAAGGAAGAAGAGAAGATCCTGGAGAGTGTTGCCGAGGGCCGAGCATTGATGTCAGTGAAGGAGATGGCTA
::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::: ::.::.::.:::   :::::::::::::::::::::::::
CGCAAAGAGTCTGCCAAGGAGAAGCAGCTGAAGGAAGAGGAGAAGATCCTGGAGAGTGTAGCTGAAGGTCGA---TTGATGTCAGTGAAGGAGATGGCTA
-R--K--E--S--A--K--E--K--Q--L--K--E--E--E--K--I--L--E--S--V--A--E--G--R-----L--M--S--V--K--E--M--A--

---------------------------------><-----------------------------------------------------------------
K--G--I--T--Y--D--D--P--I--K--T--S--W--T--P--P--R--Y--V--L--S--M--S--E--E--R--H--E--R--V--R--K--K--Y
AGGGCATTACGTATGATGACCCCATCAAAACCAGCTGGACTCCACCCCGTTATGTTCTGAGCATGTCTGAAGAGCGACATGAGCGCGTGCGGAAGAAATA
:::: ::.::.::.::.::::: ::::::      ::::: :::::::: ::::::::::::::::::::::::::.::::::::.::.::::::::.::
AGGGAATCACATACGACGACCCGATCAAA------TGGACACCACCCCGGTATGTTCTGAGCATGTCTGAAGAGCGGCATGAGCGTGTACGGAAGAAGTA
K--G--I--T--Y--D--D--P--I--K--------W--T--P--P--R--Y--V--L--S--M--S--E--E--R--H--E--R--V--R--K--K--Y

----------------------------------------------------------------------><----------------------------
--H--I--L--V--E--G--D--G--I--P--P--P--I--K--S--F--K--E--M--K--F--P--A--A--I--L--R--G--L--K--K--K--G-
CCACATCCTGGTGGAGGGAGACGGTATCCCACCACCCATCAAGAGCTTCAAGGAAATGAAGTTTCCTGCAGCCATCCTGAGAGGCCTGAAGAAGAAAGGC
:::::::.:::::::.:: ::.:: ::::::::::::::::::::.::::::::::::::.:::::::::   ::::::::::::::.::::::::.:::
CCACATCTTGGTGGAAGGTGATGGGATCCCACCACCCATCAAGAGTTTCAAGGAAATGAAATTTCCTGCA---ATCCTGAGAGGCCTAAAGAAGAAGGGC
--H--I--L--V--E--G--D--G--I--P--P--P--I--K--S--F--K--E--M--K--F--P--A-----I--L--R--G--L--K--K--K--G-

-------------------------------------------><-------------------------------------------------------
-I--H--H--P--T--P--I--Q--I--Q--G--I--P--T--I--L--S--G--R--D--M--I--G--I--A--F--T--G--S--G--K--T--L--
ATTCACCACCCAACACCCATTCAGATCCAGGGCATCCCCACCATTCTATCTGGCCGTGACATGATAGGCATCGCTTTCACGGGTTCAGGCAAGACACTGG
::.::::::::::::::::::::::::::::: ::.::::::   :: :: ::::: ::::::::::::::.::.:::::::::::::::::::::::::
ATCCACCACCCAACACCCATTCAGATCCAGGGAATTCCCACC---CTCTCAGGCCGAGACATGATAGGCATTGCCTTCACGGGTTCAGGCAAGACACTGG
-I--H--H--P--T--P--I--Q--I--Q--G--I--P--T-----L--S--G--R--D--M--I--G--I--A--F--T--G--S--G--K--T--L--

-------------------------------------------------------------------------------------------------><-
V--F--T--L--P--V--I--M--F--C--L--E--Q--E--K--R--L--P--F--S--K--R--E--G--P--Y--G--L--I--I--C--P--S--R
TGTTCACGTTGCCCGTCATCATGTTCTGCCTGGAACAAGAGAAGAGGTTACCCTTCTCAAAGCGCGAGGGGCCCTATGGACTCATCATCTGCCCCTCGCG
::::::: .:::::::::::::::::::::::::::::::::::::::::::.::::: ::::::::.:::::::::::::::::.::::::::::::  
TGTTCACCCTGCCCGTCATCATGTTCTGCCTGGAACAAGAGAAGAGGTTACCTTTCTCTAAGCGCGAAGGGCCCTATGGACTCATTATCTGCCCCTCG--
V--F--T--L--P--V--I--M--F--C--L--E--Q--E--K--R--L--P--F--S--K--R--E--G--P--Y--G--L--I--I--C--P--S---

----------------------------------------------------------------------------------------------------
--E--L--A--R--Q--T--H--G--I--L--E--Y--Y--C--R--L--L--Q--E--D--S--S--P--L--L--R--C--A--L--C--I--G--G-
GGAGCTGGCCCGGCAGACCCATGGCATCCTGGAGTACTACTGCCGCCTGCTGCAGGAGGACAGCTCACCACTCCTGCGCTGCGCCCTCTGCATTGGGGGC
                                                                   ::::::::::::::.:::::::::::.::::::
-------------------------------------------------------------------CCACTCCTGCGCTGTGCCCTCTGCATCGGGGGC
--------------------------------------------------------------------P--L--L--R--C--A--L--C--I--G--G-

----------------------------------><----------------------------------------------------------------
-M--S--V--K--E--Q--M--E--T--I--R--H--G--V--H--M--M--V--A--T--P--G--R--L--M--D--L--L--Q--K--K--M--V--
ATGTCCGTGAAAGAGCAGATGGAGACCATCCGACACGGTGTACACATGATGGTGGCCACCCCGGGGCGCCTCATGGATTTGCTGCAGAAGAAGATGGTCA
:::::.:: ::::::::::::::::::::::::   ::.::.::::::::::::::::: :: :::::::::::::::.:::::::::::::::::::::
ATGTCTGTCAAAGAGCAGATGGAGACCATCCGA---GGCGTGCACATGATGGTGGCCACACCTGGGCGCCTCATGGATCTGCTGCAGAAGAAGATGGTCA
-M--S--V--K--E--Q--M--E--T--I--R-----G--V--H--M--M--V--A--T--P--G--R--L--M--D--L--L--Q--K--K--M--V--

-------------------------------------------------------------------------------------------------><-
S--L--D--I--C--R--Y--L--A--L--D--E--A--D--R--M--I--D--M--G--F--E--G--D--I--R--T--I--F--S--Y--F--K--G
GCCTAGACATCTGTCGCTACCTGGCCCTGGACGAGGCTGACCGCATGATCGACATGGGCTTCGAGGGTGACATCCGTACCATCTTCTCCTACTTCAAGGG
::::.::::::::.::.::::::::::::::.::::::::::::::::::::::::::.::.:::::.::::::::::::::::::::::::::::::::
GCCTGGACATCTGCCGTTACCTGGCCCTGGATGAGGCTGACCGCATGATCGACATGGGTTTTGAGGGCGACATCCGTACCATCTTCTCCTACTTCAAGGG
S--L--D--I--C--R--Y--L--A--L--D--E--A--D--R--M--I--D--M--G--F--E--G--D--I--R--T--I--F--S--Y--F--K--G

----------------------------------------------------------------------------------------------------
--Q--R--Q--T--L--L--F--S--A--T--M--P--K--K--I--Q--N--F--A--K--S--A--L--V--K--P--V--T--I--N--V--G--R-
CCAGCGACAGACCCTGCTCTTCAGTGCCACCATGCCGAAGAAGATTCAGAACTTTGCTAAGAGTGCCCTTGTAAAGCCTGTGACCATCAATGTGGGGCGC
:::::::::::::::::::::::::::::::::::: ::::::::::::::.::.::.:::::.:::.: ::::::::::: :: :::::.:::::::::
CCAGCGACAGACCCTGCTCTTCAGTGCCACCATGCCTAAGAAGATTCAGAATTTCGCCAAGAGCGCCTTGGTAAAGCCTGTCACGATCAACGTGGGGCGC
--Q--R--Q--T--L--L--F--S--A--T--M--P--K--K--I--Q--N--F--A--K--S--A--L--V--K--P--V--T--I--N--V--G--R-

--------------------------------><------------------------------------------------------------------
-A--G-----A--A--S--L--D--V--I--Q--E--V--E--Y--V--K--E--E--A--K--M--V--Y--L--L--E--C--L--Q--K--T--P--
GCTGGG---GCTGCCAGCCTGGATGTCATCCAGGAGGTAGAATATGTGAAGGAGGAGGCCAAGATGGTGTACCTGCTCGAGTGCCTGCAGAAGACACCCC
::.:::   ::::::::::::::::::::::::::.::.:::::.:::::::::::.::::::::::::::::::::::::::::::::::::::::: :
GCCGGGG--GCTGCCAGCCTGGATGTCATCCAGGAAGTGGAATACGTGAAGGAGGAAGCCAAGATGGTGTACCTGCTCGAGTGCCTGCAGAAGACACCGC
-A--G--\--A--A--S--L--D--V--I--Q--E--V--E--Y--V--K--E--E--A--K--M--V--Y--L--L--E--C--L--Q--K--T--P--

----><----------------------------------------------------------------------------------------------
P--P--V--L--I--F--A--E--K--K--A--D--V--D--A--I--H--E--Y--L--L--L--K--G--V--E--A--V--A--I--H--G--G--K
CGCCTGTACTCATCTTTGCAGAGAAGAAGGCAGACGTGGACGCCATCCACGAGTACCTGCTGCTCAAGGGGGTTGAGGCCGTAGCCATCCATGGGGGCAA
::   ::.:::::::::::.::::::::: ::::.::.::::::::::::::::::::::::::::::::.::.:::::.::.:::::::::::::::::
CG---GTGCTCATCTTTGCGGAGAAGAAGCCAGATGTAGACGCCATCCACGAGTACCTGCTGCTCAAGGGAGTCGAGGCTGTGGCCATCCATGGGGGCAA
P-----V--L--I--F--A--E--K--K--P--D--V--D--A--I--H--E--Y--L--L--L--K--G--V--E--A--V--A--I--H--G--G--K

-><-------------------------------------------------------------------------------------------------
--D--Q--E--E--R--T--K--A--I--E--A--F--R--E--G--K--K--D--V--L--V--A--T--D--V--A--S--K--G--L--D--F--P-
AGACCAGGAGGAACGGACTAAGGCCATCGAGGCATTCCGGGAGGGCAAGAAGGATGTCCTAGTAGCCACAGACGTTGCCTCCAAGGGCCTGGACTTCCCT
:   ::::::::: ::::.::::::::::::::.::::::::::::::::::::::::::.:::::::::::::: ::::::::::::::::::::::::
A---CAGGAGGAAAGGACCAAGGCCATCGAGGCGTTCCGGGAGGGCAAGAAGGATGTCCTGGTAGCCACAGACGTAGCCTCCAAGGGCCTGGACTTCCCT
-----Q--E--E--R--T--K--A--I--E--A--F--R--E--G--K--K--D--V--L--V--A--T--D--V--A--S--K--G--L--D--F--P-

---------------------------------------------------><-----------------------------------------------
-A--I--Q--H--V--I--N--Y--D--M--P--E--E--I--E--N--Y--V--H--R--I--G--R--T--G--R--S--G--N--T--G--I--A--
GCCATCCAGCACGTCATCAATTATGACATGCCAGAGGAGATTGAGAACTATGTACACCGGATTGGCCGCACCGGGCGCTCGGGAAACACAGGCATCGCCA
:::::::::::.:::::::::::::::::::: ::::::::.:::::.:::   ::::: ::.::::::::.::::::::.:::::::::::::::::::
GCCATCCAGCATGTCATCAATTATGACATGCCTGAGGAGATCGAGAATTAT---CACCGTATCGGCCGCACTGGGCGCTCAGGAAACACAGGCATCGCCA
-A--I--Q--H--V--I--N--Y--D--M--P--E--E--I--E--N--Y-----H--R--I--G--R--T--G--R--S--G--N--T--G--I--A--

-----------------------><---------------------------------------------------------------------------
T--T--F--I--N--K--A--C--D--E--S--V--L--M--D--L--K--A--L--L--L--E--A--K--Q--K--V--P--P--V--L--Q--V--L
CTACCTTCATCAACAAAGCGTGTGATGAGTCAGTGCTGATGGACCTCAAAGCGCTGCTGCTAGAAGCCAAGCAGAAGGTGCCGCCCGTGCTGCAGGTGCT
:.::::::::::::::.:: :::   :::::::::::::::::::::::::: ::::::::.::.:::::::::::.:: ::.::.::::::::.:::::
CCACCTTCATCAACAAGGCCTGT---GAGTCAGTGCTGATGGACCTCAAAGCCCTGCTGCTGGAGGCCAAGCAGAAAGTTCCACCTGTGCTGCAAGTGCT
T--T--F--I--N--K--A--C-----E--S--V--L--M--D--L--K--A--L--L--L--E--A--K--Q--K--V--P--P--V--L--Q--V--L

----------------------------------><----------------------------------------------------------------
--H--C--G--D--E--S--M--L--D--I--G--G--E--R--G--C--A--F--C--G--G--L--G--H--R--I--T--D--C--P--K--L--E-
GCATTGCGGGGATGAGTCCATGCTGGACATTGGAGGAGAGCGCGGCTGTGCCTTCTGCGGGGGCCTGGGTCATCGGATCACTGACTGCCCCAAACTCGAG
.::.::.::.::.:::::::::::::::::::::   :::::.::::::::.:::::.:::::::::::.::::::::::::::::::::::::::::::
ACACTGTGGAGACGAGTCCATGCTGGACATTGGA---GAGCGTGGCTGTGCTTTCTGTGGGGGCCTGGGCCATCGGATCACTGACTGCCCCAAACTCGAG
--H--C--G--D--E--S--M--L--D--I--G-----E--R--G--C--A--F--C--G--G--L--G--H--R--I--T--D--C--P--K--L--E-

----------------------------------------------------------------------->
-A--M--Q--T--K--Q--V--S--N--I--G--R--K--D--Y--L--A--H--S--S--M--D--F--*-
GCTATGCAGACCAAGCAGGTCAGCAACATCGGTCGCAAGGACTACCTGGCCCACAGCTCCATGGACTTCTGA
::::::::::: ::::::::.::::::::.::.:::::::::::::::::::::::::::::::::::::::
GCTATGCAGACGAAGCAGGTTAGCAACATTGGCCGCAAGGACTACCTGGCCCACAGCTCCATGGACTTCTGA
-A--M--Q--T--K--Q--V--S--N--I--G--R--K--D--Y--L--A--H--S--S--M--D--F--*-

Pig Consensus Sequence

>BGISUST0000879839
---------------------------CGGGCTCGCACCGACGAGGCAACTGCCACAGGAAGCCGCTCCGAGGCGGAGGATGAGGACGATGAGGATTATG
TACCCTACGTACCACTGCGACAGCGCCGGCAGTTGCTGCTCCAGAAGCTGCTTCAGCGAAGGCGCAAGGGAGCTGCGGAAGAGGAGCAGCAGGACAGCGG
CAGCGAACCCCGAGGAGATGAGGACGACATCCCGCTGGGCCCTCAGTCCAACGTCAGCCTTCTGGATCAGCACCAGCACCTCAAGAGAAGG---------
CGCAAAGAGTCTGCCAAGGAGAAGCAGCTGAAGGAAGAGGAGAAGATCCTGGAGAGTGTAGCTGAAGGTCGA---TTGATGTCAGTGAAGGAGATGGCTA
AGGGAATCACATACGACGACCCGATCAAA------TGGACACCACCCCGGTATGTTCTGAGCATGTCTGAAGAGCGGCATGAGCGTGTACGGAAGAAGTA
CCACATCTTGGTGGAAGGTGATGGGATCCCACCACCCATCAAGAGTTTCAAGGAAATGAAATTTCCTGCA---ATCCTGAGAGGCCTAAAGAAGAAGGGC
ATCCACCACCCAACACCCATTCAGATCCAGGGAATTCCCACC---CTCTCAGGCCGAGACATGATAGGCATTGCCTTCACGGGTTCAGGCAAGACACTGG
TGTTCACCCTGCCCGTCATCATGTTCTGCCTGGAACAAGAGAAGAGGTTACCTTTCTCTAAGCGCGAAGGGCCCTATGGACTCATTATCTGCCCCTCG--
-------------------------------------------------------------------CCACTCCTGCGCTGTGCCCTCTGCATCGGGGGC
ATGTCTGTCAAAGAGCAGATGGAGACCATCCGA---GGCGTGCACATGATGGTGGCCACACCTGGGCGCCTCATGGATCTGCTGCAGAAGAAGATGGTCA
GCCTGGACATCTGCCGTTACCTGGCCCTGGATGAGGCTGACCGCATGATCGACATGGGTTTTGAGGGCGACATCCGTACCATCTTCTCCTACTTCAAGGG
CCAGCGACAGACCCTGCTCTTCAGTGCCACCATGCCTAAGAAGATTCAGAATTTCGCCAAGAGCGCCTTGGTAAAGCCTGTCACGATCAACGTGGGGCGC
GCCGGggCTGCCAGCCTGGATGTCATCCAGGAAGTGGAATACGTGAAGGAGGAAGCCAAGATGGTGTACCTGCTCGAGTGCCTGCAGAAGACACCGCCG-
--GTGCTCATCTTTGCGGAGAAGAAGCCAGATGTAGACGCCATCCACGAGTACCTGCTGCTCAAGGGAGTCGAGGCTGTGGCCATCCATGGGGGCAAA--
-CAGGAGGAAAGGACCAAGGCCATCGAGGCGTTCCGGGAGGGCAAGAAGGATGTCCTGGTAGCCACAGACGTAGCCTCCAAGGGCCTGGACTTCCCTGCC
ATCCAGCATGTCATCAATTATGACATGCCTGAGGAGATCGAGAATTAT---CACCGTATCGGCCGCACTGGGCGCTCAGGAAACACAGGCATCGCCACCA
CCTTCATCAACAAGGCCTGT---GAGTCAGTGCTGATGGACCTCAAAGCCCTGCTGCTGGAGGCCAAGCAGAAAGTTCCACCTGTGCTGCAAGTGCTACA
CTGTGGAGACGAGTCCATGCTGGACATTGGA---GAGCGTGGCTGTGCTTTCTGTGGGGGCCTGGGCCATCGGATCACTGACTGCCCCAAACTCGAGGCT
ATGCAGACGAAGCAGGTTAGCAACATTGGCCGCAAGGACTACCTGGCCCACAGCTCCATGGACTTCTGA


>BGISUSP0000879839
---------RARTDEATATGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHLKRR---
RKESAKEKQLKEEEKILESVAEGR-LMSVKEMAKGITYDDPIK--WTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKFPA-ILRGLKKKG
IHHPTPIQIQGIPT-LSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPS-----------------------PLLRCALCIGG
MSVKEQMETIR-GVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGR
AGAASLDVIQEVEYVKEEAKMVYLLECLQKTPP-VLIFAEKKPDVDAIHEYLLLKGVEAVAIHGGK-QEERTKAIEAFREGKKDVLVATDVASKGLDFPA
IQHVINYDMPEEIENY-HRIGRTGRSGNTGIATTFINKAC-ESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIG-ERGCAFCGGLGHRITDCPKLEA
MQTKQVSNIGRKDYLAHSSMDF*