Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000127325 (click for geneview)
Transcript ID ENST00000330891(link to ensembl)
Symbol VMD2L3
Localtion Chromosome:12:68334689:68379463:-1 band: 12q15
Description Bestrophin-4 (Vitelliform macular dystrophy 2-like protein 3). [Source:Uniprot/SWISSPROT;Acc:Q8N1M1]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--V--T--Y--S--S--K--V--A--N--A--T--F--F--G--F--H--R--L--L--L--K--W--R--G--S--I--Y--K--L--L--Y--
ATGACTGTCACTTACTCCAGTAAAGTAGCAAATGCAACTTTTTTTGGATTTCATAGGTTACTCCTCAAGTGGAGAGGCAGCATCTACAAACTACTGTACA
:::::::::::::::::::::::::::::::::::.::::   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATGACTGTCACTTACTCCAGTAAAGTAGCAAATGCGACTTGGGTTGGATTTCATAGGTTACTCCTCAAGTGGAGAGGCAGCATCTACAAACTACTGTACA
-M--T--V--T--Y--S--S--K--V--A--N--A--T--W--V--G--F--H--R--L--L--L--K--W--R--G--S--I--Y--K--L--L--Y--

---------------------------------------------------><-----------------------------------------------
R--E--F--I--V--F--A--V--L--Y--T--A--I--S--L--V--Y--R--L--L--L--T--G--V--Q--K--R--Y--F--E--K--L--S--I
GGGAATTTATTGTTTTTGCTGTTCTTTATACAGCAATAAGTTTGGTATACAGATTGTTACTTACAGGAGTCCAAAAACGTTACTTTGAAAAATTATCAAT
:::::::::::::.::::::::::::::.:::::::::::::::.:.:::                                                  
GGGAATTTATTGTCTTTGCTGTTCTTTACACAGCAATAAGTTTGATGTAC--------------------------------------------------
R--E--F--I--V--F--A--V--L--Y--T--A--I--S--L--M--Y---------------------------------------------------

----------------------------------------------><----------------------------------------------------
--Y--C--D--R--Y--A--E--Q--I--P--V--T--F--V--L--G--F--Y--V--T--L--V--V--N--R--W--W--N--Q--F--V--N--L-
TTACTGTGACAGATATGCTGAACAAATTCCAGTAACCTTTGTGCTTGGGTTTTATGTTACTCTGGTAGTGAACCGATGGTGGAACCAGTTTGTGAATTTG
                                                 ::::::::::::::::::::::::::::::::::::::::::::::::.::
-------------------------------------------------TTTTATGTTACTCTGGTAGTGAACCGATGGTGGAACCAGTTTGTGAATCTG
--------------------------------------------------F--Y--V--T--L--V--V--N--R--W--W--N--Q--F--V--N--L-

----------------------------------------------------------------------------------------------------
-P--W--P--D--R--L--M--F--L--I--S--S--S--V--H--G--S--D--E--H--G--R--L--L--R--R--T--L--M--R--Y--V--N--
CCCTGGCCAGACAGGCTAATGTTCCTCATCTCTAGCAGTGTTCACGGAAGCGACGAGCACGGGCGCCTGCTTAGAAGGACGCTGATGCGCTACGTCAATC
:::::::::::::::::.:::::.::::::::.:::::::::::::::::.:::::::::::::::.::::.::::::::.:::::::::::.:::::::
CCCTGGCCAGACAGGCTGATGTTTCTCATCTCCAGCAGTGTTCACGGAAGTGACGAGCACGGGCGCTTGCTCAGAAGGACACTGATGCGCTATGTCAATC
-P--W--P--D--R--L--M--F--L--I--S--S--S--V--H--G--S--D--E--H--G--R--L--L--R--R--T--L--M--R--Y--V--N--

--------------------------------------------------------------------------------><------------------
L--T--S--L--L--I--F--R--S--V--S--T--A--V--Y--K--R--F--P--T--M--D--H--V--V--E--A--G--F--M--T--T--D--E
TCACCTCCCTGCTCATCTTTCGCTCGGTGAGCACTGCTGTGTACAAAAGATTTCCCACAATGGACCACGTGGTTGAAGCAGGTTTTATGACAACAGATGA
:::: ::::::::::::::.:::::.:::::::: ::::::::::::::.::::: ::.:::::::::::::::::::::   :::::::::.:::::::
TCACATCCCTGCTCATCTTCCGCTCAGTGAGCACAGCTGTGTACAAAAGGTTTCCGACGATGGACCACGTGGTTGAAGCA---TTTATGACAGCAGATGA
L--T--S--L--L--I--F--R--S--V--S--T--A--V--Y--K--R--F--P--T--M--D--H--V--V--E--A-----F--M--T--A--D--E

----------------------------------------------------------------------------------------------------
--R--K--L--F--N--H--L--K--S--P--H--L--K--Y--W--V--P--F--I--W--F--G--N--L--A--T--K--A--R--N--E--G--R-
AAGGAAATTATTCAACCACCTCAAGTCTCCTCATCTGAAATATTGGGTTCCATTCATCTGGTTTGGAAATCTTGCAACTAAAGCCCGGAATGAAGGTAGA
:::.::::::::..::::::::::.:::::::::::::::::.:::::::::::::::::::::::::::::.:::.::::::::::::: :::::::::
AAGAAAATTATTTGACCACCTCAAATCTCCTCATCTGAAATACTGGGTTCCATTCATCTGGTTTGGAAATCTCGCAGCTAAAGCCCGGAAGGAAGGTAGA
--R--K--L--F--D--H--L--K--S--P--H--L--K--Y--W--V--P--F--I--W--F--G--N--L--A--A--K--A--R--K--E--G--R-

-----------------------------------><---------------------------------------------------------------
-I--R--D--S--V--D--L--Q--S--L--M--T--E--M--N--R--Y--R--S--W--C--S--L--L--F--G--Y--D--W--V--G--I--P--
ATCAGAGACAGTGTTGATCTGCAATCATTGATGACTGAAATGAATCGATACCGCTCTTGGTGCAGCCTCTTATTCGGTTATGACTGGGTTGGGATTCCGC
::::::::::::::::::::::::::::::::::::::::::::.:::: .:::::.:::::::::::::::::.:::::::::::::::::::::::.:
ATCAGAGACAGTGTTGATCTGCAATCATTGATGACTGAAATGAACCGATTTCGCTCCTGGTGCAGCCTCTTATTTGGTTATGACTGGGTTGGGATTCCAC
-I--R--D--S--V--D--L--Q--S--L--M--T--E--M--N--R--F--R--S--W--C--S--L--L--F--G--Y--D--W--V--G--I--P--

-------------><-------------------------------------------------------------------------------------
L--V--Y--T--Q--V--V--T--L--A--V--Y--T--F--F--F--A--C--L--I--G--R--Q--F--L--D--P--T--K--G--Y--A--G--H
TGGTTTACACCCAGGTTGTCACTCTTGCTGTCTATACCTTCTTCTTTGCGTGCCTGATTGGACGCCAGTTTTTGGATCCCACCAAAGGCTACGCAGGGCA
:::::::::::::::::::::: :: ::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.:::::
TGGTTTACACCCAGGTTGTCACGCTGGCTGTCTATACCTTCTTCTTCGCGTGCCTGATTGGACGCCAGTTTTTGGATCCCACCAAAGGCTACGCGGGGCA
L--V--Y--T--Q--V--V--T--L--A--V--Y--T--F--F--F--A--C--L--I--G--R--Q--F--L--D--P--T--K--G--Y--A--G--H

------------------------------------------------------------------><--------------------------------
--D--L--D--L--Y--I--P--I--F--T--L--L--Q--F--F--F--Y--A--G--W--L--K--V--A--E--Q--L--I--N--P--F--G--E-
TGACTTGGATCTTTACATTCCCATCTTCACCCTCCTACAATTCTTCTTCTATGCAGGATGGCTTAAGGTAGCAGAGCAGCTTATCAACCCTTTTGGAGAA
::::::.::::::::::::::::::::.::.::::::::::::::::::::::::::::::::.:::                                 
TGACTTAGATCTTTACATTCCCATCTTTACTCTCCTACAATTCTTCTTCTATGCAGGATGGCTCAAG---------------------------------
--D--L--D--L--Y--I--P--I--F--T--L--L--Q--F--F--F--Y--A--G--W--L--K----------------------------------

-----------------------------------------------><---------------------------------------------------
-D--D--D--D--F--E--T--N--W--C--I--D--R--N--L--Q--V--S--L--L--A--V--D--E--M--H--M--S--L--P--K--M--K--
GATGATGATGATTTTGAAACTAACTGGTGCATTGACAGAAATTTGCAGGTCTCTCTTTTAGCTGTGGACGAAATGCACATGAGCTTACCCAAGATGAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------->
K--D--I--Y--W--D--D--S--A--A--R--P--P--Y--T--L--A--A--A--D--Y--C--I--P--S--F--L--G--S--T--V--Q--M--G
AGGACATTTACTGGGACGATTCTGCTGCTCGCCCACCATACACATTGGCAGCTGCTGACTACTGCATACCCTCATTTCTGGGGTCAACAGTCCAGATGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

<---------------------------------------------------------------------------------------------------
--L--S--G--S--D--F--P--D--E--E--W--L--W--D--Y--E--K--H--G--H--R--H--S--M--I--R--R--V--K--R--F--L--S-
GCTGTCTGGGTCCGACTTTCCTGACGAGGAGTGGCTGTGGGATTATGAGAAGCATGGCCATCGGCATTCCATGATAAGAAGAGTCAAGCGGTTCCTGAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--H--E--H--P--S--S--P--R--R--R--S--Y--R--R--Q--T--S--D--S--S--M--F--L--P--R--D--D--L--S--P--A--R--
GCCCACGAACACCCCTCCAGCCCCAGAAGAAGAAGCTACAGGAGGCAGACAAGTGACAGCTCCATGTTCTTACCCCGAGATGACCTCAGCCCAGCCAGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--L--L--D--V--P--S--R--N--P--P--R--A--S--P--T--W--K--K--S--C--F--P--E--G--S--P--T--L--H--F--S--M--G
ACCTACTGGATGTGCCCTCAAGAAACCCCCCCAGGGCCTCACCCACCTGGAAGAAATCCTGCTTCCCAGAAGGAAGCCCCACGCTGCACTTCAGCATGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--L--S--T--I--R--E--T--S--Q--T--S--T--L--Q--S--L--T--P--Q--S--S--V--R--T--S--P--I--K--M--P--L--V-
AGAGCTGTCCACCATCAGGGAGACCAGCCAGACAAGCACTTTACAGAGCCTGACCCCACAGTCCAGTGTGAGAACTTCCCCCATCAAAATGCCACTGGTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--E--V--L--I--T--A--A--E--A--P--V--P--T--S--G--G--Y--H--H--D--S--A--T--S--I--L--S--S--E--F--T--G--
CCTGAGGTATTGATCACAGCAGCCGAAGCACCAGTGCCCACATCAGGGGGCTACCACCATGATTCCGCTACCTCCATCTTGAGCTCTGAGTTTACAGGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
V--Q--P--S--K--T--E--Q--Q--Q--G--P--M--G--S--I--L--S--P--S--E--K--E--T--P--P--G--G--P--S--P--Q--T--V
TTCAGCCAAGCAAGACTGAGCAGCAGCAGGGCCCCATGGGATCCATCCTGTCTCCCTCAGAGAAGGAGACACCTCCTGGAGGCCCCAGTCCCCAGACAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--A--S--A--E--E--N--I--F--N--C--E--E--D--P--G--D--T--F--L--K--R--W--S--L--P--G--F--L--G--S--S--H-
TTCAGCCAGCGCTGAGGAAAATATATTCAACTGTGAAGAAGACCCTGGTGATACCTTTCTAAAAAGGTGGAGTCTTCCGGGATTCCTGGGGTCCAGCCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--S--L--G--N--L--S--P--D--P--M--S--S--Q--P--A--L--L--I--D--T--E--T--S--S--E--I--S--G--I--N--I--V--
ACTTCCCTGGGAAACCTAAGTCCAGACCCCATGAGCTCTCAGCCAGCTCTTTTAATTGACACAGAAACATCCTCAGAGATCAGTGGGATCAACATTGTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--G--S--R--V--S--S--D--M--L--Y--L--M--E--N--L--D--T--K--E--T--D--I--I--E--L--N--K--E--T--E--E--S--P
CTGGCTCTCGAGTCTCTTCTGATATGCTGTATTTAATGGAAAACCTGGACACCAAGGAAACAGATATCATAGAGCTGAACAAGGAAACTGAGGAATCACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------>
--K--*-
CAAATGA
       
-------
-------

Pig Consensus Sequence

>BGISUST0000895972
ATGACTGTCACTTACTCCAGTAAAGTAGCAAATGCGACTTGGGTTGGATTTCATAGGTTACTCCTCAAGTGGAGAGGCAGCATCTACAAACTACTGTACA
GGGAATTTATTGTCTTTGCTGTTCTTTACACAGCAATAAGTTTGATGTAC--------------------------------------------------
-------------------------------------------------TTTTATGTTACTCTGGTAGTGAACCGATGGTGGAACCAGTTTGTGAATCTG
CCCTGGCCAGACAGGCTGATGTTTCTCATCTCCAGCAGTGTTCACGGAAGTGACGAGCACGGGCGCTTGCTCAGAAGGACACTGATGCGCTATGTCAATC
TCACATCCCTGCTCATCTTCCGCTCAGTGAGCACAGCTGTGTACAAAAGGTTTCCGACGATGGACCACGTGGTTGAAGCA---TTTATGACAGCAGATGA
AAGAAAATTATTTGACCACCTCAAATCTCCTCATCTGAAATACTGGGTTCCATTCATCTGGTTTGGAAATCTCGCAGCTAAAGCCCGGAAGGAAGGTAGA
ATCAGAGACAGTGTTGATCTGCAATCATTGATGACTGAAATGAACCGATTTCGCTCCTGGTGCAGCCTCTTATTTGGTTATGACTGGGTTGGGATTCCAC
TGGTTTACACCCAGGTTGTCACGCTGGCTGTCTATACCTTCTTCTTCGCGTGCCTGATTGGACGCCAGTTTTTGGATCCCACCAAAGGCTACGCGGGGCA
TGACTTAGATCTTTACATTCCCATCTTTACTCTCCTACAATTCTTCTTCTATGCAGGATGGCTCAAG---------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------


>BGISUSP0000895972
MTVTYSSKVANATWVGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLMY---------------------------------FYVTLVVNRWWNQFVNL
PWPDRLMFLISSSVHGSDEHGRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEA-FMTADERKLFDHLKSPHLKYWVPFIWFGNLAAKARKEGR
IRDSVDLQSLMTEMNRFRSWCSLLFGYDWVGIPLVYTQVVTLAVYTFFFACLIGRQFLDPTKGYAGHDLDLYIPIFTLLQFFFYAGWLK-----------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------