Sequences
EST Library Info
eye1Foetus 50 days, Eye
nmm3Newborn 115 days, mucosal membranes
tes4Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000151023 (click for geneview)
Transcript ID ENST00000331161(link to ensembl)
Symbol NP_659447.1
Localtion Chromosome:10:25310923:25345036:-1 band: 10p12.1
Description enkurin [Source:RefSeq_peptide;Acc:NP_659447]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------><----------------------
-M--D--P--T--C--S--S--E--C--I--Y--N--L--I--P--S--D--L--K--E--P--P--Q--P--P--R--Y--I--S--I--F--K--A--
ATGGATCCAACGTGCTCTTCTGAGTGCATTTATAACCTCATACCCAGTGACTTGAAGGAGCCTCCCCAGCCTCCTAGGTACATATCCATTTTTAAGGCAA
:::::::::::::.:::::::::: ::::::::::::::::::::::::::: ::::::::::::.:::::::::   :::::::: :::::::::::::
ATGGATCCAACGTACTCTTCTGAGAGCATTTATAACCTCATACCCAGTGACTGGAAGGAGCCTCCTCAGCCTCCT---TACATATCAATTTTTAAGGCAA
-M--D--P--T--Y--S--S--E--S--I--Y--N--L--I--P--S--D--W--K--E--P--P--Q--P--P-----Y--I--S--I--F--K--A--

----------------------------------------------------------------------------------------------------
T--V--K--D--D--M--Q--K--A--K--T--A--M--K--T--M--G--P--A--K--V--E--V--P--S--P--K--D--F--L--K--K--H--S
CTGTAAAAGATGACATGCAAAAAGCTAAAACTGCAATGAAAACTATGGGACCAGCAAAAGTTGAAGTACCTTCTCCAAAGGATTTCCTAAAGAAACATTC
:::::::::::::::::::.::: .::::::::::::::::::.::::::::::::::: ::::::::::::::::::::::::::.:.::::::::.::
CTGTAAAAGATGACATGCAGAAATTTAAAACTGCAATGAAAACCATGGGACCAGCAAAACTTGAAGTACCTTCTCCAAAGGATTTCTTGAAGAAACACTC
T--V--K--D--D--M--Q--K--F--K--T--A--M--K--T--M--G--P--A--K--L--E--V--P--S--P--K--D--F--L--K--K--H--S

----------------------><----------------------------------------------------------------------------
--K--E--K--T--L--P--P--K--K--N--F--D--R--N--V--P--K--K--P--A--V--P--L--K--T--D--H--P--V--M--G--I--Q-
AAAGGAAAAAACTCTACCACCCAAAAAAAACTTTGATCGGAACGTGCCCAAAAAGCCTGCTGTGCCATTGAAGACTGATCATCCTGTCATGGGAATACAG
 :::::::::::::::::::::   ::::: ::::::::: :.: ::::::::::::: ::::::::::::..::::: ::::: :::::::::::::::
TAAGGAAAAAACTCTACCACCC---AAAAAGTTTGATCGGCATGAGCCCAAAAAGCCTCCTGTGCCATTGAGAACTGAACATCCAGTCATGGGAATACAG
--K--E--K--T--L--P--P-----K--K--F--D--R--H--E--P--K--K--P--P--V--P--L--R--T--E--H--P--V--M--G--I--Q-

----------------------------------------------------------------------------------------------------
-S--G--K--N--F--I--N--T--N--A--A--D--I--I--M--G--V--A--K--K--P--K--P--I--Y--V--D--K--R--T--G--D--K--
AGTGGAAAAAATTTTATAAATACAAATGCAGCTGATATCATCATGGGAGTGGCTAAAAAGCCTAAACCAATTTATGTTGATAAAAGAACTGGAGACAAGC
::::.::::::.::::::::::::::::::::..::.::::.:::::::::::::::::::::::::::.::::::::::.:::::::::::.:::::::
AGTGAAAAAAACTTTATAAATACAAATGCAGCCAATGTCATTATGGGAGTGGCTAAAAAGCCTAAACCAGTTTATGTTGACAAAAGAACTGGGGACAAGC
-S--E--K--N--F--I--N--T--N--A--A--N--V--I--M--G--V--A--K--K--P--K--P--V--Y--V--D--K--R--T--G--D--K--

----------------------------------------------><----------------------------------------------------
H--D--L--E--P--S--G--L--V--P--K--Y--I--N--K--K--D--Y--G--V--T--P--E--Y--I--C--K--R--N--E--E--I--K--K
ATGATCTTGAGCCTTCAGGACTAGTTCCAAAGTACATCAATAAAAAGGATTATGGTGTCACACCTGAATACATATGTAAGCGAAACGAGGAAATAAAGAA
::::.:::::. :::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.::::::::::::::.::::::.:.:::::
ATGACCTTGAAACTTCAGGACTAGTTCCAAAGTACATCAATAAAAAGGATTATGGTGTCACGCCTGAATATATATGTAAGCGAAATGAGGAAGTGAAGAA
H--D--L--E--T--S--G--L--V--P--K--Y--I--N--K--K--D--Y--G--V--T--P--E--Y--I--C--K--R--N--E--E--V--K--K

---------------------------------------------------------------------------------------------><-----
--A--Q--E--D--Y--D--R--Y--I--Q--E--N--L--K--K--A--A--M--K--R--L--S--D--E--E--R--E--A--V--L--Q--G--L-
AGCCCAAGAAGACTATGATCGTTATATCCAGGAAAACCTTAAGAAAGCAGCTATGAAAAGGCTCTCCGATGAAGAAAGGGAGGCAGTTTTGCAGGGGCTG
:::::::::::: :::::: ..:::::::::::::::::.:.::::::::::::::::::.:: ::.:::::::::::::::::.:::.:::::::::::
AGCCCAAGAAGAATATGATAACTATATCCAGGAAAACCTCAGGAAAGCAGCTATGAAAAGACTGTCTGATGAAGAAAGGGAGGCGGTTCTGCAGGGGCTG
--A--Q--E--E--Y--D--N--Y--I--Q--E--N--L--R--K--A--A--M--K--R--L--S--D--E--E--R--E--A--V--L--Q--G--L-

----------------------------------------------------------------------------------------------------
-K--K--N--W--E--E--V--H--K--E--F--Q--S--L--S--V--F--I--D--S--I--P--K--K--I--R--K--Q--R--L--E--E--E--
AAAAAGAACTGGGAAGAGGTGCATAAAGAATTCCAGTCCCTCTCGGTCTTTATAGATTCTATACCAAAGAAGATCCGCAAGCAGAGGCTGGAAGAAGAAA
::::::::::::::.:::::::::::.::.::::::::::::::.:::::.:: ::.::.::::: :::::::: ::::::::::.:::.::::::::.:
AAAAAGAACTGGGAGGAGGTGCATAAGGAGTTCCAGTCCCTCTCAGTCTTCATCGACTCCATACCTAAGAAGATGCGCAAGCAGAAGCTAGAAGAAGAGA
-K--K--N--W--E--E--V--H--K--E--F--Q--S--L--S--V--F--I--D--S--I--P--K--K--M--R--K--Q--K--L--E--E--E--

---------------------------------------------------------------><----->
M--K--Q--L--E--H--D--I--G--I--I--E--K--H--K--I--I--Y--I--A--N--N--A--*-
TGAAACAACTAGAACACGACATTGGCATAATTGAAAAGCACAAGATTATTTATATTGCCAATAACGCATGA
::::.::.::.::.::.::::::: ..:  :.:::::::::::.::.:::::::::::.:::         
TGAAGCAGCTGGAGCATGACATTGCTGTCCTCGAAAAGCACAAAATCATTTATATTGCTAAT---------
M--K--Q--L--E--H--D--I--A--V--L--E--K--H--K--I--I--Y--I--A--N----------

Pig Consensus Sequence

>BGISUST0000897280
ATGGATCCAACGTACTCTTCTGAGAGCATTTATAACCTCATACCCAGTGACTGGAAGGAGCCTCCTCAGCCTCCT---TACATATCAATTTTTAAGGCAA
CTGTAAAAGATGACATGCAGAAATTTAAAACTGCAATGAAAACCATGGGACCAGCAAAACTTGAAGTACCTTCTCCAAAGGATTTCTTGAAGAAACACTC
TAAGGAAAAAACTCTACCACCC---AAAAAGTTTGATCGGCATGAGCCCAAAAAGCCTCCTGTGCCATTGAGAACTGAACATCCAGTCATGGGAATACAG
AGTGAAAAAAACTTTATAAATACAAATGCAGCCAATGTCATTATGGGAGTGGCTAAAAAGCCTAAACCAGTTTATGTTGACAAAAGAACTGGGGACAAGC
ATGACCTTGAAACTTCAGGACTAGTTCCAAAGTACATCAATAAAAAGGATTATGGTGTCACGCCTGAATATATATGTAAGCGAAATGAGGAAGTGAAGAA
AGCCCAAGAAGAATATGATAACTATATCCAGGAAAACCTCAGGAAAGCAGCTATGAAAAGACTGTCTGATGAAGAAAGGGAGGCGGTTCTGCAGGGGCTG
AAAAAGAACTGGGAGGAGGTGCATAAGGAGTTCCAGTCCCTCTCAGTCTTCATCGACTCCATACCTAAGAAGATGCGCAAGCAGAAGCTAGAAGAAGAGA
TGAAGCAGCTGGAGCATGACATTGCTGTCCTCGAAAAGCACAAAATCATTTATATTGCTAAT---------


>BGISUSP0000897280
MDPTYSSESIYNLIPSDWKEPPQPP-YISIFKATVKDDMQKFKTAMKTMGPAKLEVPSPKDFLKKHSKEKTLPP-KKFDRHEPKKPPVPLRTEHPVMGIQ
SEKNFINTNAANVIMGVAKKPKPVYVDKRTGDKHDLETSGLVPKYINKKDYGVTPEYICKRNEEVKKAQEEYDNYIQENLRKAAMKRLSDEEREAVLQGL
KKNWEEVHKEFQSLSVFIDSIPKKMRKQKLEEEMKQLEHDIAVLEKHKIIYIAN---