Sequences
EST Library Info
eru1Foetus 50 days, regio umbilicalis
pigcb1Unavailable
pliv1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000175395 (click for geneview)
Transcript ID ENST00000332033(link to ensembl)
Symbol ZNF25
Localtion Chromosome:10:38278801:38305459:-1 band: 10p11.21
Description Zinc finger protein 25 (Zinc finger protein KOX19). [Source:Uniprot/SWISSPROT;Acc:P17030]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------><------------------------------------------------------------------------------------
-M--N--K--F--Q--G--P--V--T--L--K--D--V--I--V--E--F--T--K--E--E--W--K--L--L--T--P--A--Q--R--T--L--Y--
ATGAACAAGTTCCAGGGACCCGTGACATTAAAGGATGTTATTGTGGAATTCACCAAGGAAGAATGGAAGTTACTGACCCCTGCTCAGAGGACTCTGTATA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------><---------------------------------------------------------
K--D--V--M--L--E--N--Y--S--H--L--V--S--V--G--Y--H--V--N--K--P--N--A--V--F--K--L--K--Q--G--K--E--P--W
AGGATGTGATGCTGGAAAACTATAGTCACCTTGTCTCAGTGGGTTACCATGTGAATAAGCCAAATGCAGTCTTCAAGTTGAAGCAAGGAAAAGAGCCATG
                                            ::...:::::::::.::::::::::::::::::::.::::::::::::::::::::
--------------------------------------------TATTGTGTGAATAAACCAAATGCAGTCTTCAAGTTAAAGCAAGGAAAAGAGCCATG
---------------------------------------------Y--C--V--N--K--P--N--A--V--F--K--L--K--Q--G--K--E--P--W

-------------------------------------><-------------------------------------------------------------
--I--L--E--V--E--F--P--H--R--G--F--P--E--D--L--W--S--I--H--D--L--E--A--R--Y--Q--E--S--Q--A--G--N--S-
GATATTAGAAGTAGAATTTCCACATCGGGGCTTCCCTGAAGACCTATGGAGCATTCATGATCTAGAAGCAAGATACCAGGAAAGCCAAGCTGGAAATTCA
:::::::::::::::::::::::.:::...:  ::::                                                               
GATATTAGAAGTAGAATTTCCACGTCGAAACAACCCT---------------------------------------------------------------
--I--L--E--V--E--F--P--R--R--N--N--P----------------------------------------------------------------

-><-------------------------------------------------------------------------------------------------
-R--N--G--E--L--T--K--H--Q--K--T--H--T--T--E--K--A--C--E--C--K--E--C--G--K--F--F--C--Q--K--S--A--L--
AGGAATGGAGAACTCACAAAACATCAGAAAACTCATACCACAGAGAAAGCCTGTGAATGTAAGGAATGTGGGAAGTTCTTCTGCCAGAAGTCTGCCCTCA
   ::::::::::::::::::: ::::.:::::: ::::: :::::::.:::.:.::::::: ::::::::.::::.:::::::::.::.:::..:::::
---AATGGAGAACTCACAAAACCTCAGGAAACTCTTACCAGAGAGAAAACCTATAAATGTAATGAATGTGGAAAGTCCTTCTGCCAAAAATCTATCCTCA
----N--G--E--L--T--K--P--Q--E--T--L--T--R--E--K--T--Y--K--C--N--E--C--G--K--S--F--C--Q--K--S--I--L--

----------------------------------------------------------------------------------------------------
I--V--H--Q--H--T--H--S--K--G--K--S--Y--D--C--D--K--C--G--K--S--F--S--K--N--E--D--L--I--R--H--Q--K--I
TAGTACATCAGCATACTCACTCAAAGGGCAAATCCTATGACTGTGATAAATGTGGGAAATCTTTCTCTAAAAATGAAGACCTCATAAGACATCAGAAAAT
.:.::::::::::::::::.:::::::.::::.:: ..:: ::::. :::               ::: ..:::::::::::::.:::::: :::::::.
CAATACATCAGCATACTCATTCAAAGGACAAACCCAGCGAATGTGGGAAA---------------TCTCGGAATGAAGACCTCACAAGACAACAGAAAAC
T--I--H--Q--H--T--H--S--K--D--K--P--S--E--C--G--K-----------------S--R--N--E--D--L--T--R--Q--Q--K--T

----------------------------------------------------------------------------------------------------
--H--T--R--D--K--T--Y--E--C--K--E--C--K--K--I--F--Y--H--L--S--S--L--S--R--H--L--R--T--H--A--G--E--K-
TCACACGAGAGATAAAACCTATGAGTGTAAAGAATGTAAGAAAATATTTTACCACCTATCATCTCTCAGTAGACATCTGAGAACCCATGCAGGAGAGAAA
: :.:: ::::: :::::::::::.:::::::::::::::::::. ::.::::::::.::::::::::::::::::.:::::::.:::::::::::::::
TAATACCAGAGAGAAAACCTATGAATGTAAAGAATGTAAGAAAACTTTCTACCACCTGTCATCTCTCAGTAGACATTTGAGAACTCATGCAGGAGAGAAA
--N--T--R--E--K--T--Y--E--C--K--E--C--K--K--T--F--Y--H--L--S--S--L--S--R--H--L--R--T--H--A--G--E--K-

----------------------------------------------------------------------------------------------------
-P--Y--E--C--N--Q--C--E--K--S--F--Y--Q--K--P--H--L--T--E--H--Q--K--T--H--T--G--E--K--P--F--E--C--T--
CCCTATGAATGTAATCAGTGTGAAAAATCCTTCTACCAGAAACCACATCTCACAGAACATCAGAAAACACACACAGGGGAGAAACCTTTTGAATGTACTG
:::::.:::::::::::::::::.:::::::::::::::::.:::::.::::..:::::::::::::::::::::::.::::::::.: :::::::::::
CCCTACGAATGTAATCAGTGTGAGAAATCCTTCTACCAGAAGCCACACCTCATGGAACATCAGAAAACACACACAGGAGAGAAACCCTATGAATGTACTG
-P--Y--E--C--N--Q--C--E--K--S--F--Y--Q--K--P--H--L--M--E--H--Q--K--T--H--T--G--E--K--P--Y--E--C--T--

----------------------------------------------------------------------------------------------------
E--C--G--K--F--F--Y--V--K--A--Y--L--M--V--H--Q--K--T--H--T--G-----E--K--P--Y--E--C--K--E--C--G--K--A
AATGTGGGAAGTTCTTCTATGTGAAGGCATACCTCATGGTACATCAGAAAACACACACAGGG---GAGAAACCCTATGAGTGTAAGGAGTGTGGGAAAGC
:::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::   :::::.:: :::::.::::::::.:::.::::: :
AATGTGGGAAGTTCTTCTATGTTAAGGCATACCTCATGGTACATCAGAAAACACACACAGGGG--GAGAAGCCATATGAATGTAAGGAATGTAGGAAATC
E--C--G--K--F--F--Y--V--K--A--Y--L--M--V--H--Q--K--T--H--T--G--\--E--K--P--Y--E--C--K--E--C--R--K--S

----------------------------------------------------------------------------------------------------
--F--S--Q--K--S--H--L--T--V--H--Q--R--M--H--T--G--E--K--P--Y--K--C--K--E--C--G--K--F--F--S--R--N--S-
CTTTTCCCAGAAGTCACACCTCACAGTACATCAGAGAATGCACACAGGGGAGAAACCCTATAAATGTAAGGAATGTGGGAAATTCTTCTCTAGGAATTCA
::::::::::::.:::::::::::::::::::::::::..::.::::::::::::::::::::::::::::::::::::::::::::::::::.::::::
CTTTTCCCAGAAATCACACCTCACAGTACATCAGAGAACACATACAGGGGAGAAACCCTATAAATGTAAGGAATGTGGGAAATTCTTCTCTAGAAATTCA
--F--S--Q--K--S--H--L--T--V--H--Q--R--T--H--T--G--E--K--P--Y--K--C--K--E--C--G--K--F--F--S--R--N--S-

----------------------------------------------------------------------------------------------------
-H--L--K--T--H--Q--R--S--H--T--G--E--K--P--Y--E--C--K--E--C--R--K--C--F--Y--Q--K--S--A--L--T--V--H--
CACCTCAAAACTCATCAGAGAAGTCACACAGGAGAGAAACCCTATGAATGTAAGGAATGTAGGAAATGCTTCTACCAGAAGTCAGCCCTCACAGTACATC
:::::::::::::::::::::: ::::::.::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::: ::::::::::
CACCTCAAAACTCATCAGAGAACTCACACGGGAGAGAAACCCTATGAATGTAAGGAATGTGGGAAATGCTTCTACCAGAAGTCAGCCCTAACAGTACATC
-H--L--K--T--H--Q--R--T--H--T--G--E--K--P--Y--E--C--K--E--C--G--K--C--F--Y--Q--K--S--A--L--T--V--H--

----------------------------------------------------------------------------------------------------
Q--R--T--H--T--G--E--K--P--F--E--C--N--K--C--G--K--T--F--Y--Y--K--S--D--L--T--K--H--Q--R--K--H--T--G
AGCGAACTCACACAGGGGAGAAACCCTTTGAATGTAATAAATGTGGGAAAACATTTTACTATAAATCAGACCTCACTAAACATCAGAGAAAACACACAGG
::::::::::::::::::::::.::::::::::::::::::::::::::::  :::::::::::::::::::::::.:::::::::::::::::::::::
AGCGAACTCACACAGGGGAGAAGCCCTTTGAATGTAATAAATGTGGGAAAAACTTTTACTATAAATCAGACCTCACCAAACATCAGAGAAAACACACAGG
Q--R--T--H--T--G--E--K--P--F--E--C--N--K--C--G--K--N--F--Y--Y--K--S--D--L--T--K--H--Q--R--K--H--T--G

----------------------------------------------------------------------------------------------------
--E--K--P--Y--E--C--T--E--C--G--K--S--F--A--V--N--S--V--L--R--L--H--Q--R--T--H--T--G--E--K--P--Y--A-
GGAGAAGCCCTATGAATGCACAGAATGTGGCAAATCTTTTGCTGTGAATTCAGTCCTCAGATTACATCAAAGGACTCACACAGGAGAGAAGCCCTATGCA
::::::::::::::::::.:  ::.::::: ::::::::. ::::::::::::::::::::::::::::::::::::::::.::::::::.::.:::: :
GGAGAAGCCCTATGAATGTAATGAGTGTGGGAAATCTTTCTCTGTGAATTCAGTCCTCAGATTACATCAAAGGACTCACACGGGAGAGAAACCTTATGAA
--E--K--P--Y--E--C--N--E--C--G--K--S--F--S--V--N--S--V--L--R--L--H--Q--R--T--H--T--G--E--K--P--Y--E-

----------------------------------------------------------------------------------------------------
-C--K--E--C--G--K--S--F--S--Q--K--S--H--F--I--I--H--Q--R--K--H--T--G--E--K--P--Y--E--C--Q--E--C--G--
TGCAAGGAATGTGGGAAGTCCTTTTCTCAGAAGTCACATTTTATTATACATCAGAGAAAACACACAGGGGAGAAGCCCTATGAGTGTCAGGAGTGTGGGG
::.::::::::::::::.:::::.::::::::.:::::::::.:.:::::::::::::::::::::::.::.::.:::: :::.::::::::::::..:.
TGTAAGGAATGTGGGAAATCCTTCTCTCAGAAATCACATTTTGTCATACATCAGAGAAAACACACAGGAGAAAAACCCTTTGAATGTCAGGAGTGTAAGA
-C--K--E--C--G--K--S--F--S--Q--K--S--H--F--V--I--H--Q--R--K--H--T--G--E--K--P--F--E--C--Q--E--C--K--

------------------------------------------------------------------------->
E--T--F--I--Q--K--S--Q--L--T--A--H--Q--K--T--H--T--K--K--R--N--A--E--K--*-
AAACCTTTATCCAGAAGTCACAACTCACTGCACATCAGAAGACACACACAAAGAAGAGGAATGCTGAGAAGTAA
::::.::: :::::::.::: :::::::::::::::::::::::::::::.:...::..:..            
AAACTTTTTTCCAGAAATCAAAACTCACTGCACATCAGAAGACACACACAGAAGGGAAAAGC------------
K--T--F--F--Q--K--S--K--L--T--A--H--Q--K--T--H--T--E--G--K--S-------------

Pig Consensus Sequence

>BGISUST0000896981
----------------------------------------------------------------------------------------------------
--------------------------------------------TATTGTGTGAATAAACCAAATGCAGTCTTCAAGTTAAAGCAAGGAAAAGAGCCATG
GATATTAGAAGTAGAATTTCCACGTCGAAACAACCCT---------------------------------------------------------------
---AATGGAGAACTCACAAAACCTCAGGAAACTCTTACCAGAGAGAAAACCTATAAATGTAATGAATGTGGAAAGTCCTTCTGCCAAAAATCTATCCTCA
CAATACATCAGCATACTCATTCAAAGGACAAACCCAGCGAATGTGGGAAATCTCGGAATGAAGACCTCACAAGACAACAGAAAACTAATACCAGAGAGAA
AACCTATGAATGTAAAGAATGTAAGAAAACTTTCTACCACCTGTCATCTCTCAGTAGACATTTGAGAACTCATGCAGGAGAGAAACCCTACGAATGTAAT
CAGTGTGAGAAATCCTTCTACCAGAAGCCACACCTCATGGAACATCAGAAAACACACACAGGAGAGAAACCCTATGAATGTACTGAATGTGGGAAGTTCT
TCTATGTTAAGGCATACCTCATGGTACATCAGAAAACACACACAGGggAGAAGCCATATGAATGTAAGGAATGTAGGAAATCCTTTTCCCAGAAATCACA
CCTCACAGTACATCAGAGAACACATACAGGGGAGAAACCCTATAAATGTAAGGAATGTGGGAAATTCTTCTCTAGAAATTCACACCTCAAAACTCATCAG
AGAACTCACACGGGAGAGAAACCCTATGAATGTAAGGAATGTGGGAAATGCTTCTACCAGAAGTCAGCCCTAACAGTACATCAGCGAACTCACACAGGGG
AGAAGCCCTTTGAATGTAATAAATGTGGGAAAAACTTTTACTATAAATCAGACCTCACCAAACATCAGAGAAAACACACAGGGGAGAAGCCCTATGAATG
TAATGAGTGTGGGAAATCTTTCTCTGTGAATTCAGTCCTCAGATTACATCAAAGGACTCACACGGGAGAGAAACCTTATGAATGTAAGGAATGTGGGAAA
TCCTTCTCTCAGAAATCACATTTTGTCATACATCAGAGAAAACACACAGGAGAAAAACCCTTTGAATGTCAGGAGTGTAAGAAAACTTTTTTCCAGAAAT
CAAAACTCACTGCACATCAGAAGACACACACAGAAGGGAAAAGC------------


>BGISUSP0000896981
------------------------------------------------YCVNKPNAVFKLKQGKEPWILEVEFPRRNNP---------------------
-NGELTKPQETLTREKTYKCNECGKSFCQKSILTIHQHTHSKDKPSECGKSRNEDLTRQQKTNTREKTYECKECKKTFYHLSSLSRHLRTHAGEKPYECN
QCEKSFYQKPHLMEHQKTHTGEKPYECTECGKFFYVKAYLMVHQKTHTGEKPYECKECRKSFSQKSHLTVHQRTHTGEKPYKCKECGKFFSRNSHLKTHQ
RTHTGEKPYECKECGKCFYQKSALTVHQRTHTGEKPFECNKCGKNFYYKSDLTKHQRKHTGEKPYECNECGKSFSVNSVLRLHQRTHTGEKPYECKECGK
SFSQKSHFVIHQRKHTGEKPFECQECKKTFFQKSKLTAHQKTHTEGKS----